Identifiers and Description

Gene Model Identifier

Contig13946.0.g19

Standard Name

MRPL41a

Aliases

Contig13946_0_g19

Description

Mitochondrial ribosomal protein L27

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam09809 ) Mitochondrial ribosomal protein L27

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003161606.001696815660978e-24hypothetical protein
SGDYBR282W0.0002999184360822198MRPL27 SGDID:S000000486, Chr I
I from 768240-768680, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13946.0.g19(coding)
ATGATGAACAACGTTCACTTCTTAGCTTAATAAAACATGAACTCGCTCATCTACCAATAA
GTCTTTGGATTTTCTAAGTTCAGAAAGAGACTTGGTCTTTACTCTTACAAACTGACCAAA
AATAACAAGTTCAGAGACCCTCATGCCATGCCACTCTATTAAAAGTAATAATACAAGAAG
CAAGGCTACAAAGGAGAAATTAAGATTAGAGAAGTGACCAGAAACTCTGAGAGACCTTTT
GGTAAAATCTCTAGAAAGGGTAATTTTTCTTTTGAAATTCAAAAGGTACCATTCTATAAC
GTTCCTGACCTCACAAACTTCAAGCTTAAGCCATATGTTTCCTATACCACCCCAAAGGTT
GGAGATTAAGATAAAGTATAGAAGCAGATTGCAATGACTCCAGATCTCCTCGAAGATATT
AATCAACAAATTTTGAATGCACCAAAGGGAAGTCTCATTCCTAGAAATCAGCTAGACCCC
GTTTCAGCACTTTCAAGAAAGACTAGATGA


>Contig13946.0.g19(protein)
MMNNVHFLAQQNMNSLIYQQVFGFSKFRKRLGLYSYKLTKNNKFRDPHAMPLYQKQQYKK
QGYKGEIKIREVTRNSERPFGKISRKGNFSFEIQKVPFYNVPDLTNFKLKPYVSYTTPKV
GDQDKVQKQIAMTPDLLEDINQQILNAPKGSLIPRNQLDPVSALSRKTR