Identifiers and Description

Gene Model Identifier

Contig13396.0.g40

Standard Name

MRPL4

Aliases

Contig13396_0_g40

Description

Ribosomal protein L4/L1 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00573 ) Ribosomal protein L4/L1 family

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005642803.9998411574835458e-50ribosomal protein L4/L1 family
protein
SGDYML025C0.000000000010004361180063202YML6 SGDID:S000004487, Chr XII
I from 225239-224406,2253...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13396.0.g40(coding)
ATGCCAAGCCAGAAATTGTTTCCCTAGAGATTTGCCTCATCAGTAGTCCAAGCGAATGCT
CAATTTGATATTAAGAACTTCCAATTGCCCAAATAAGACCAAGCATTAATTGTAGAAAGA
CCATGGGCAACTAAACCATTCATTATCAACGAGCAATAACCTTTGAATTTACCTATTTTC
GATTTAAAGTCTGGAACTTTTACTGGAAATTTGTGCAATCTAGACCCAAGCATTTATAAC
TTGCCATTAAGAAGAGATATTGTGTTCAGAGTGAACTCTTATTTCGATAACTTGGGTAAA
ATTAAGACTCATAGAACTAAGACAAGAGGAGATGTTGCTGGTTCAGGTGCAAAGATGAGA
CCTCAAAAGAAGAGTGGTAGAGCCAGACAGGGTGATAAAAGAGCTCCACATCTATGGAAA
GGTGGTAAAGCTCACGGTCCAGTGCCAATGGATTACACTTTCCAGTTAAACGAAAAAATT
AGACTTTTAGCATTGAAAACTATCTTAAGTGCAAAACTCTATGAAGACAGACTCATTCTT
ATTGATTCAGAAGCCCTCGAATATGGAAAGACTAAGTACTTAAATGAAATTATTGCTCCT
TACAAAAGAGATAAAATTTTGTTCTTGCATAGTTTCCTCCCAGATACCAACTTCGTTCAA
GCAGCTTCAAATATTGAGACACTAAACTTGGTGAATCCACAGCAATTTAACTTAAAGCCA
GTTTTGAATCACGATTGGATTTTCGCTTCAGTCTAGGGTCTGAAAGAGCTTGAAATGATT
ATTGAGAGCAGAGATGAAAATCTCTATAGAAACAGGAAGGTTCCCAGAGAGTCACTTGGA
TTTGATGCCGTTCTTGGACCTTAGATTCGTCTTAAGGAGAGAAAGAGAGACAGATTTGAA
GAAGATATCATTAAATCTATACTTGAGAGAGAAGACGAGGAGTTAGATAGCAAGCCACTT
GAGATTGTCACAGAGAGTTTAAGAGGGTACATGCAAGACTTACAGCAATTACAAAATACT
AAACTTGAATCACATTAGCAATGA


>Contig13396.0.g40(protein)
MPSQKLFPQRFASSVVQANAQFDIKNFQLPKQDQALIVERPWATKPFIINEQQPLNLPIF
DLKSGTFTGNLCNLDPSIYNLPLRRDIVFRVNSYFDNLGKIKTHRTKTRGDVAGSGAKMR
PQKKSGRARQGDKRAPHLWKGGKAHGPVPMDYTFQLNEKIRLLALKTILSAKLYEDRLIL
IDSEALEYGKTKYLNEIIAPYKRDKILFLHSFLPDTNFVQAASNIETLNLVNPQQFNLKP
VLNHDWIFASVQGLKELEMIIESRDENLYRNRKVPRESLGFDAVLGPQIRLKERKRDRFE
EDIIKSILEREDEELDSKPLEIVTESLRGYMQDLQQLQNTKLESHQQ