Identifiers and Description

Gene Model Identifier

Contig22111.0.g38

Standard Name

MRPL3

Aliases

Contig22111_0_g38

Description

Ribosomal protein L3

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003018601.9998944264638884e-101ribosomal protein L3 containin
g protein
SGDYGR220C8.001824328206442e-49MRPL9 SGDID:S000003452, Chr VI
I from 936883-936074, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22111.0.g38(coding)
ATGACTATGACATAATTAAGAGACCTTGGATATGAAAATCTTAAAAAGGAAAAGATCATT
GATTATGGCAAGGTAGCTCTACCAAATGTTCATGGAGTAACAAATAAAAAGAGTTCTTTC
AGATCATTTGATGATCAACTTAATGAGCAATTTAATAGAGAAATTGTCAATACTGCCCCA
TAAAACATGTACTCTAAGAGAGTTGGATTGATTGGATACAAGATGGGAATGACACACTTC
TGGAATAAATGGGGAGTCCATGTACCATGTACAGTAATCTAAATTGACAGATGCTAAGTA
ACCTAAGTAAAGACTCTTGAAAAGGATGGTGTCAACTCAATTCAAATTGGTTGTGGTGAG
GAGAGACTCAAGACTTTGAAGAAACCATAAGCTGGTCACTTCTTGAAATATAACATTCCA
CCAAAGGCAGATCTTGCAGAGTTTGTAGTCACACCAGAAAACTTCTTACCCCTTGGTTAT
TTTCTTGGTCCAAGACACTTTAAAATCGGCCAATTAGTTGATGTTAGGTCAACTTCAATC
GGTAAAGGTTTCCAAGGAGTCATGAAGAGATGGAATTTCTCAGGTTAAAACGCTACTCAT
GGTAACTCAGTCTCTCACAGACATCCAGGTTCCATCGGTAACAGAGAGTATCCAGGTAAA
GTTTTCAAAAACAAAAAGATGGCTGGTCAAATGGGAAACCAAAGTAGTACTGTACTCAAT
TAAAGAGTAGTTAAAATTGATGTTGAGAGAAGCTTGCTCTACATTTAAGGTAACGTGCCA
GGCTCTATCAGTTCCCTTGTGAGAATTAGAGACGCAGTCAAGTTATGTCAGAAGTAATAT
TTAGATTTGGAATACCCAACTTGGCTACCACCCACTGATGATGCAGAATACCATGCTCTT
CCAAGACAGTTAGTTTGGGAAGGTCCAACAGTAGATCCAAATGAAGAATACATTCACGAA
AATGATGTAGTTTCCGGAAAAGACCAAGAAGACGATTGA


>Contig22111.0.g38(protein)
MTMTQLRDLGYENLKKEKIIDYGKVALPNVHGVTNKKSSFRSFDDQLNEQFNREIVNTAP
QNMYSKRVGLIGYKMGMTHFWNKWGVHVPCTVIQIDRCQVTQVKTLEKDGVNSIQIGCGE
ERLKTLKKPQAGHFLKYNIPPKADLAEFVVTPENFLPLGYFLGPRHFKIGQLVDVRSTSI
GKGFQGVMKRWNFSGQNATHGNSVSHRHPGSIGNREYPGKVFKNKKMAGQMGNQSSTVLN
QRVVKIDVERSLLYIQGNVPGSISSLVRIRDAVKLCQKQYLDLEYPTWLPPTDDAEYHAL
PRQLVWEGPTVDPNEEYIHENDVVSGKDQEDD