Identifiers and Description

Gene Model Identifier

Contig13444.0.g102

Standard Name

MRPL28

Aliases

Contig13444_0_g102

Description

Ribosomal L28 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00830 ) Ribosomal L28 family
  • ( pfam06847 ) Archaeal Peptidase A24 C-terminus Type II
  • ( pfam06217 ) GAGA binding protein-like family

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001409805.9971655715910366e-21ribosomal protein L28 containi
ng protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13444.0.g102(coding)
ATGATCAAGCAATAGTCATTCTCAAGTTAAGCAAAGAGCTAGTTGGGTACTGATACACCT
GCCCATAGCAGCAGACATCACAGAGGACTTTTCCATAGAAAGACTCATGGCAAAAAGTAT
CAAAGATGTTTCTCAATGAAGCAGTCAATTAAAACACAAAAACCAAATGTTAAAGGCAAA
ACACTCTAATCTCATATCTTGGGTCAATCCTTCAAGCTTGAACTGTCAATGAAAGCCAGA
AAATGCATAATGAAGGCAGGTTCTCTTGATAAGTATCTCTTAAACACTAGTCCAGCAGAT
ATCGATTCTAAGTTTGGTATCATGCTCAGAGATTATATTAAGCAAAAACAATCCAACCCT
GACTTTGAGGTACCATACATCCCAGGTCAAGCAAAATTAAGCAGAACCAAGCAAACTACA
GTTTGGGAGTATAAGCAGATTCCTGCTATTTACATGCCAGCGAAAGTGAAGGTGAGTCAA
GATCAAAGCAAGTTCTATTTCAAGACTCCTCAAGAGATGTCCAGATATGAAATTTCTGAG
TTGGAGAGACTATTGCGTGAAATCGATGAGCCTGATGTATTCGTCCCAGATGAAATCCTC
TATGCATCCAAAGAATTCTTGGAACTTAAAGATCAAATGCGCATGATGCAACCAATCAGA
CATGGTCTTATTAGGAGATTCTTGGAGAAGGTTAAGTGGTAGAAGAGAAAGAGAGAGAAC
TTACTCGCTCATATTGAAACAACTGAAAGTAGTCCAAGAGATATTCTTGGTGATGAGTAC
ATTCATTTCTTGGATGCCATGCCAGACTACAAGCTTTTCCTTGAGGAAATCAGAGCTAAG
GAAGCAATTAGAGATCAAGAACTTGCAGCTAGACTTGAAGGCCTAGATGAAGAAGAACTT
GAATAAGCTGAAGTCGATAAGGAATCAAAGAAGGCGAAGAAGGTAGCATCAGGATCAAAG
AAGAGCAAAAATAAGAAGAGAATGATGGAGGAGGAAGAGGAAGACGAGGAATCGGTGTTA
CAAGAGAGGGCTGATAGAGCTGTCAAATCCACCAAAGCCCAAAAGGCAAAACAATTAAGA
GAAGTATCATTCGATCCATAGACATTCAACCCCTTCGATCCCGAAAACATTAAGAAAGAC
GAAGGTCTTAAAAAGAAGCTGCTCTAACCCAAGAGAGTCTTCAAGGAGAAGGTGGCATAG
TGA


>Contig13444.0.g102(protein)
MIKQQSFSSQAKSQLGTDTPAHSSRHHRGLFHRKTHGKKYQRCFSMKQSIKTQKPNVKGK
TLQSHILGQSFKLELSMKARKCIMKAGSLDKYLLNTSPADIDSKFGIMLRDYIKQKQSNP
DFEVPYIPGQAKLSRTKQTTVWEYKQIPAIYMPAKVKVSQDQSKFYFKTPQEMSRYEISE
LERLLREIDEPDVFVPDEILYASKEFLELKDQMRMMQPIRHGLIRRFLEKVKWQKRKREN
LLAHIETTESSPRDILGDEYIHFLDAMPDYKLFLEEIRAKEAIRDQELAARLEGLDEEEL
EQAEVDKESKKAKKVASGSKKSKNKKRMMEEEEEDEESVLQERADRAVKSTKAQKAKQLR
EVSFDPQTFNPFDPENIKKDEGLKKKLLQPKRVFKEKVAQ