Identifiers and Description

Gene Model Identifier

Contig9049.0.g92

Standard Name

MRPL27

Aliases

Contig9049_0_g92

Description

Ribosomal L27 protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004198504.998978211117678e-38ribosomal protein L27 containi
ng protein
SGDYNL005C8.000721090200152e-18MRP7 SGDID:S000004950, Chr XIV
from 622428-621313, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9049.0.g92(coding)
ATGATTGTTTCAAAGTTCTACAACTACTAAGTTAGAAACTTTGCCACTAAGATGATGGCA
GGTTCCACAAACAACAGCAAGGATAGTGCTGGTAGAAGATTAGGTATTAAGAAGTTCGGC
CCAGCTGAGACTTTGGAAAACGAGATTGTAGCCAGACAAAGAGGTCTTAAATGGCATCCC
GGTGATCATGTTCACTACGGCAAAGATCACACACTCCATGCGACTACTGAAGGTGTTTTG
GGGTGGTCTAGAAACCCATATGGATTCAAGAAGAGATCTTACATTCACGTTATTCCACAA
GAAATTCCAAACAGAAAATTCCCAGCACCTCCTCCATTCGCATATCACCCAGAATTATAC
CCAGAACTCGCACTTAAAAACCCTGAGCCAACTAACTTCAAAATTCCAAGATGTCAACCA
AAGAAAAAGAGAAATCCATCAACACTTCATGCTAAGGTTGTTGCTCCAGAAAATGTACAG
AGAATTGAAATAAAAAATATGTCCTAGCAATTGTTTAAGTATCATACCAAATACGCATTT
GAAAACTATAGCACTGAGAAACATATGGAATTCTAATCACACCTTGATGATAAAGTCAGC
AAGCATTTCGGAAAAAAGTTATTGCAATGA


>Contig9049.0.g92(protein)
MIVSKFYNYQVRNFATKMMAGSTNNSKDSAGRRLGIKKFGPAETLENEIVARQRGLKWHP
GDHVHYGKDHTLHATTEGVLGWSRNPYGFKKRSYIHVIPQEIPNRKFPAPPPFAYHPELY
PELALKNPEPTNFKIPRCQPKKKRNPSTLHAKVVAPENVQRIEIKNMSQQLFKYHTKYAF
ENYSTEKHMEFQSHLDDKVSKHFGKKLLQ