Identifiers and Description

Gene Model Identifier

Contig9287.0.g107

Standard Name

MRPL24

Aliases

Contig9287_0_g107

Description

KOW motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006974201.999534248571833e-46ribosomal protein L24 containi
ng protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9287.0.g107(coding)
ATGAACTAACTCCTCCTGAAAAAGAATGCAATCGCTATGATTAACAATCAAATGCGTCAC
TTTGGTTACAGACCCAAACAAGAGACCTTTGATAAGTGGAACATAGTCAGAGATGATTTT
GTGGAAGTAATTTCTGGTAAATACAAGAAAACTCAAGGCAAGATACTTGAAGTTGATAGA
AAAAACAACACTGTCATAGTCCAAGGAGTCAATTTGAAATACAAAACAGTGAAGGACGAT
GAATATGTGGAGAGAAGAAAGACAGTGCAGCAGGAGAAGCCAATTCATGTGTCAAACGTC
TCACTTATAGACCCAGAAACTGGCACTCCCACTAGAGTCAGATATGGGTTCTTGGAGGAT
GGCGCCAAGGTAAGAATTGCCAAGAAGAGTGGAGCACTTATTCCAAAGCCAGATCGCAGC
AACTTGACTTACATTAATCGTACAAAGGGCAAGGAGACAGGATTAAACGACACTAAGCCA
GAGGATACTCTTGAAAGAACATACGCTGGTGAGGACTTCTTGAGAGTGAAAGCTGAATTC
GATGAGTACATCAGAATGAAGGAAGAGAAAGAAGGATTAATGGTCTTCAAGGAAAAGAAT
CCTTATGTTATCAACTAATCTGCTGCAGCTAGAAGTTGA


>Contig9287.0.g107(protein)
MNQLLLKKNAIAMINNQMRHFGYRPKQETFDKWNIVRDDFVEVISGKYKKTQGKILEVDR
KNNTVIVQGVNLKYKTVKDDEYVERRKTVQQEKPIHVSNVSLIDPETGTPTRVRYGFLED
GAKVRIAKKSGALIPKPDRSNLTYINRTKGKETGLNDTKPEDTLERTYAGEDFLRVKAEF
DEYIRMKEEKEGLMVFKEKNPYVINQSAAARS