Identifiers and Description

Gene Model Identifier

Contig1642.0.g21

Standard Name

MRPL22

Aliases

Contig1642_0_g21

Description

Ribosomal protein L22p/L17e

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00237 ) Ribosomal protein L22p/L17e
  • ( pfam14432 ) DYW family of nucleic acid deaminases

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000525103.998609120989657e-17hypothetical protein
SGDYJL177W0.0005997485943342685RPL17B SGDID:S000003713, Chr X
from 90786-91094,91412-9...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1642.0.g21(coding)
ATGTTAGTAAACAAGAGTCTAACCTTCCTCAAGAAGAGCATCCACTCCTACAAATCCCAA
CTCCCTACTAATTCTTTCATGACATTAAACTAACCAAATCTCTATAAATCTCAGCTCAAT
CTTACTAATTAAATGTTAAATAGACCCATTCTATCCCCTATGATGCAATAAACTATGTTC
ATGAGTAGATAATTTTCAAGTTAAGTGGTCGCAGAGTAGTAAAGTGTCACTCCATAACTT
AAAATTAAGCGTAATACTGCCACTGATGAATTGTAACTATTAGATAGAAAATTACCCAAA
ACAGCTGCTCCATAGTGCTTTTTCCCTCAAACTATAGTCAAGAAGATTAATCGTACACAA
ATAGCCTAGAAGAAAAACATTAAATACTCAGCAATTAAGTTAAACGCTGCTTGTATGGTT
GTTCGTAAGAGACATTTGCAAGACGCTTTACAGCAAATTTAAGTCTGTAACAAGAAAGGT
GGTCCACTTGTTAAATCAGTTCTTGAAGCAGCCAGAGCTAACGCAGTGAAAAAGGGATTA
TAAGAAGAAAGATTATTTGTTAAAGAGTGCATAGTAGGCAAGGCTCTTGGTCAAAAGAAA
ATGGATATCAGAGCTAGAGGTAAATTCGGTATGATCCATGCACCTAAATCCTCAATCAGG
ATTGTTTTGGAAGAGAAGTAACCAGAGGACTTTTTCAAGTTGCTTGTTAAGGGTTAATGC
CCTGCTTCAATAGGAGAGATGTTCAGAAAGATGCTCTATGTAAACCAAGCAAGTTTTGAA
TAAGTTAGAAAGTTCTCTTTCATGACAACTGCAAAGGGTAGATACTACAGAAAAGTCTAA
TTCCAAAGACTGTGCCAATTGATCCAAAAAGATTATGCAAAGCAAGGCTCACCTATGTCC
TACTAAAAGATTGAGAGAAATCTATTGGAGAAGGCCAGCAGAGATTACGTTGAGGATTAT
CAAAACTCTATGGAGAAGAGCATGCTCACATCACATACCGAAAGACAAGCACACTTCGAA
CAAAACTACAAAAAGAAGTGA


>Contig1642.0.g21(protein)
MLVNKSLTFLKKSIHSYKSQLPTNSFMTLNQPNLYKSQLNLTNQMLNRPILSPMMQQTMF
MSRQFSSQVVAEQQSVTPQLKIKRNTATDELQLLDRKLPKTAAPQCFFPQTIVKKINRTQ
IAQKKNIKYSAIKLNAACMVVRKRHLQDALQQIQVCNKKGGPLVKSVLEAARANAVKKGL
QEERLFVKECIVGKALGQKKMDIRARGKFGMIHAPKSSIRIVLEEKQPEDFFKLLVKGQC
PASIGEMFRKMLYVNQASFEQVRKFSFMTTAKGRYYRKVQFQRLCQLIQKDYAKQGSPMS
YQKIERNLLEKASRDYVEDYQNSMEKSMLTSHTERQAHFEQNYKKK