Identifiers and Description

Gene Model Identifier

Contig2346.0.g89

Standard Name

MRPL21

Aliases

Contig2346_0_g89

Description

Ribosomal prokaryotic L21 protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00829 ) Ribosomal prokaryotic L21 protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002809902.0000236365077126e-43ribosomal protein L21 containi
ng protein
SGDYJL096W0.0000009995106777214876MRPL49 SGDID:S000003632, Chr X
from 246490-246975, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2346.0.g89(coding)
ATGTTTAAATTGCATAATTTGCAATCAACCACTAACAGGTTGTTTGCTACACCAGCTTTG
TTTAGACCACTTGCACAAGCCGTTTAATAACCTACTCTTTTCAGTAATTAATAAGCTCAT
TTCAGTGAATTCTTTAAGGAGCAGGACAAGAAGAGTATTGATAAGATGTACTGGAAATTG
AATGAAAATAAATACTGGAAATCAATCCAGGATAAATGGTAGAAACCACTGGAAAGAAAG
AAGATTTTAAAATAAAAAAGATTAGAGAACCCAGTTGTTCCTAAGGAAGAGCAAGAAACT
CCAAGTTTGTACGTACATAATGAAGAGCAGGGAGTTGAGTTGCCACCCAATCCTAATGAA
ATATTTGCAGTAGTGAGAATCAAAGGCCTGTAATACAAAGTAACAAAGGATGACAGATTA
ATGAGTGAGTGGCTTGAAGACTTTGAAGTAGGGCAATAAATCGAATTAAGTGAAGTGCTC
CTTGTTGGAACTACTGATTACACTTGTGTCGGAAGACCAACAGTATCCTAGGCTAAAGTA
TTTGCCACAGTTGAAGAGCATACTCAAACTGAGAAGACTTTAATATTCAAGAAGCGTAGA
AGAAAGGGTAATTCTCAAAGACACTAAGGTCACAGACAGTGGGTTACAGTTCTAAAAATT
GACAAAATTGTTCATGATGTTGACGAGACTAATGTTTAACAAAGAACTGAAATTAATCAT
CTTGAACATAAACCAACTGTAGCAATTATGTGA


>Contig2346.0.g89(protein)
MFKLHNLQSTTNRLFATPALFRPLAQAVQQPTLFSNQQAHFSEFFKEQDKKSIDKMYWKL
NENKYWKSIQDKWQKPLERKKILKQKRLENPVVPKEEQETPSLYVHNEEQGVELPPNPNE
IFAVVRIKGLQYKVTKDDRLMSEWLEDFEVGQQIELSEVLLVGTTDYTCVGRPTVSQAKV
FATVEEHTQTEKTLIFKKRRRKGNSQRHQGHRQWVTVLKIDKIVHDVDETNVQQRTEINH
LEHKPTVAIM