Identifiers and Description

Gene Model Identifier

Contig15153.0.g102

Standard Name

MRPL20

Aliases

Contig15153_0_g102

Description

Ribosomal protein L20

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010344605.997739233660418e-28ribosomal protein L20 containi
ng protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15153.0.g102(coding)
ATGCAAGCCTTGTTTGAAATTGCGAATTTGACTAATCACATACCGTTTTCATATGATCTC
CAGACTAAGAGATCATTTGATATAACCTAATAAATGAGGATCCTTGAAAAGAATATAGCT
TCATTTATTGGATCCTCAGGTTTCGCAGCTCTATATCCAGATCTAACAGATTCTAAGTCT
CAATATTACAGTATGAATAACATTGATAAGATGCTGTACATGCTTAGAAACTATAATTAA
ACAGTCTATGACAACATATTCTACTTCGATTATTTTTATTACAAAGATCAGCCTACGTTG
CAATAATAATGCCAATAAATGTTATCTTAGAGTATTGCTGGGGTACAGCAAAACTTTCAT
TAACTGTATTTAATTATGAGATAGAAGAAGGGCATAGACACAGACTAAGATATTACTTTA
TTAATGAAGACATTCCTTGATTAGTGTGCCAACAATACTTGCACTTAAAGACTTGAATGG
TTCATCAATACACTATCTGGTAACAATCCTAATTTCACATAATGCGATAGTATGTGGAGA
GTGTCAAATTTTGATAAATTAAACCGTACATTTTCCACTGTCAGAAATAGGTTTTCAGCT
TCCGCAGCCTATTTGGTCGCTTCCATGAGTGCTGCATTAACAGTTGAAAGTGCATACAGA
ACTTTATCGACTTAGGATTTAAGTTATTGGAAAAACATTCAATTCAAATATGAGGTCAAG
ATTAGAGATGTACTTCAAAGATTCAGAAGAATGGACAAAGCTTTGATGGATAACATGAAG
AATAGTGTCTATACTTTTGTTAGTAGGTACATAATATCTCCTGATATTATTAATCTTGGC
CCAGAAAAAGTTTCATTAAATCTTAGAAATCTACTACCAAAGTACTATCAGGACGCTACC
TCTTGGTTGATTGTTATGATACCCATTAATGATGTCTACAAATTATCAAGCAACAACTAT
TACAATTGTGAGACTTGCTTCTTGATTTAAGATACCGCTCTACCTAATGAAAGTTACTAC
TACATCTTTGTATCTTATTCCTTGAAGAGTATTGACAATAAGAAATATCTTAGTTAATTT
GATTGGAAAACATTATTAGCAAATAAAACTAGTCAAGAGAAAGCTTAATTAGCTTACAAT
GGTGGATTTTGTGTCTCTGGAGTATACTCATTCCTGAAAACAGATGGCTAAATTTTCATC
TATAATACAGACGAAAATTATTTAATTATAGAAAACACTTTTATCTGGTCTCAAAAAGCT
GATTGTCCATCCACATCTACAATGACCAACTAAGATAAAATCAACAACAATACTAATGAA
AAGGTCTTCAGACTGGCCAAGGGATTTACAGGCAGATCAAACAATTGTTTCGGTCTTGCC
CTCAGAAGAGTTCATAAATCACTGCAGTATGCTTATAGAGATAGAAAAGTCAAGAAGAGA
AGAACTAGAAGAGCTTGGATTCATACTATTAATGCTGCAGTCAGAGAACATGGAATTAGT
TATTCAAGATTCCAATTTGGTCTTACTAGATCAAACATTCAATTGGATAGAAAAATTCTC
TCAGACCTCGCAGTTAACGAACCTTTCTCATTCAAAGCAGTGATTGAAGAAGTTCACAAA
TAAGTCGATTTTAAGGAGCAAGTAAAGGTCAAGCCAAGATATTTGCAAGCCAGAGGAATT
TCTTATGATCAAGCTTTGCAATAAGGTTATTTGAGAACAACTGTTCCTACTAAGGAAGAG
CTTATTGAAATTGAAAAGTCACTTATTCCACCACAAGCTCAGATGTTCGGTTTAAGATTC
CCAGAAAGAGATAGCAAGACACCAGCAGATTACATGAGGCTCAGCTATAAAGAAGAAGAT
GAGAAATTCCTCAAGGAGCAGGAGAGATTCACCCTCACAGAAAAAGAGCAAAAGAAAATG
CCAAGAGAAGTTTTGCAAGATAATTGGGACGAGGACATGTCAGTCTACAAAGATAAGAGA
AAGCCATGA


>Contig15153.0.g102(protein)
MQALFEIANLTNHIPFSYDLQTKRSFDITQQMRILEKNIASFIGSSGFAALYPDLTDSKS
QYYSMNNIDKMLYMLRNYNQTVYDNIFYFDYFYYKDQPTLQQQCQQMLSQSIAGVQQNFH
QLYLIMRQKKGIDTDQDITLLMKTFLDQCANNTCTQRLEWFINTLSGNNPNFTQCDSMWR
VSNFDKLNRTFSTVRNRFSASAAYLVASMSAALTVESAYRTLSTQDLSYWKNIQFKYEVK
IRDVLQRFRRMDKALMDNMKNSVYTFVSRYIISPDIINLGPEKVSLNLRNLLPKYYQDAT
SWLIVMIPINDVYKLSSNNYYNCETCFLIQDTALPNESYYYIFVSYSLKSIDNKKYLSQF
DWKTLLANKTSQEKAQLAYNGGFCVSGVYSFLKTDGQIFIYNTDENYLIIENTFIWSQKA
DCPSTSTMTNQDKINNNTNEKVFRLAKGFTGRSNNCFGLALRRVHKSLQYAYRDRKVKKR
RTRRAWIHTINAAVREHGISYSRFQFGLTRSNIQLDRKILSDLAVNEPFSFKAVIEEVHK
QVDFKEQVKVKPRYLQARGISYDQALQQGYLRTTVPTKEELIEIEKSLIPPQAQMFGLRF
PERDSKTPADYMRLSYKEEDEKFLKEQERFTLTEKEQKKMPREVLQDNWDEDMSVYKDKR
KP