Identifiers and Description

Gene Model Identifier

Contig12612.0.g76

Standard Name

MRPL17

Aliases

Contig12612_0_g76

Description

Ribosomal protein L17

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001069699.997019043202629e-21hypothetical protein
SGDYJL063C0.0000000000019997478866288316MRPL8 SGDID:S000003599, Chr X
from 316475-315759, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12612.0.g76(coding)
ATGAGACACAAGAACGCTCATAGAAAGTTTGGAAGAGACTACAAACATGTTAAAGCTATG
CTTAGAAACCTTGTTACAAGCTTGGTGAAGCACGATAGAATTACTACAACCATGGCCAAG
GCAAAGGAATTAAGACCCCTTGCAGACAAGATTATTCACAAAGCCAAGCAGAACGATTAC
CAGGGCAACTTGTTCTTATATAAAACTCTCTTCACAAAGGATGCAATTATGAGAGCAAAG
AAGGAACTCGCTCAGAGATTCCAAAATCAAGCTGGTGGTTTTGTAAGAGTTAAATACCTC
GGTGAGAGAAAGAACGACAGAGCTAAGATTGGATATATTGAATACATAAACAACCCAATT
GAAATTTATGAGAAGAACGAGTTGGCTCAGGAAAGAGAGAGGACTGGTTTGCCCTCATTC
TGGTCTTGGGAAAAGAAATTACTCAAGCAAGAGATTGCATATTTCAAGGGACTAATCAAG
CAATTGAATGGTGTTATCAATCATGAAGTTGAACAAACTTTGGCTAAATCAAATGCTACC
TCAACTGGACCAGAAATGGAAGCTTTCAATGAATAAATAAGAAAGGACATCGAGGCAAAA
TACGAGAAAAAGAGACAGTTTTTGAAATTCTCACTTGAGAGAGCCAGGAATGAAGATAGA
CAGCACAAAAAGGAAGAGACCATGAAGAAATACGATAGAATGTGGGATTTCTACTCTGAT
TCTGATCCTATTCTTAAGCTCAAGGATGCTGCTAGAATTTGA


>Contig12612.0.g76(protein)
MRHKNAHRKFGRDYKHVKAMLRNLVTSLVKHDRITTTMAKAKELRPLADKIIHKAKQNDY
QGNLFLYKTLFTKDAIMRAKKELAQRFQNQAGGFVRVKYLGERKNDRAKIGYIEYINNPI
EIYEKNELAQERERTGLPSFWSWEKKLLKQEIAYFKGLIKQLNGVINHEVEQTLAKSNAT
STGPEMEAFNEQIRKDIEAKYEKKRQFLKFSLERARNEDRQHKKEETMKKYDRMWDFYSD
SDPILKLKDAARI