Identifiers and Description

Gene Model Identifier

Contig14865.0.1.g43

Standard Name

MRPL15

Aliases

Contig14865_0_1_g43

Description

Ribosomal protein L18e/L15

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001362404.999934616708877e-52ribosomal protein L15 containi
ng protein
SGDYNL284C3.999672240330216e-26MRPL10 SGDID:S000005228, Chr X
IV from 104102-103134, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14865.0.1.g43(coding)
ATGGGAAGTATGCAAAAGAAGAACTTTGTTTCGATAGCCCCTCAAGGATTGTCTGAGTAC
TAATTAGAGAAGAAAGTATTGATGCCTTTCACTATTGGAAACCTTTGGGATAACACTGGT
GCCAGATAATAATTCAAGAGAGTTGGTAGAGGTCCAGGTTCTGGTCTAGGAAAGACAAGT
GGTCGTGGTAACAAAGGTATGAAATTCAGAGCTGGTGGTTAAGTAAACAGAGGTTTCGAA
GGTGGTCAAACTAATTTGGCAAGAAGATTCCCAAAGAGAGGTATTAGAAAGAATAAGTTC
AACGTGAAGTAAGAACTTACTCAGTTGAACCTTGGAAAGCTAGCTTATTTCATTGAAAAA
GGGCTCATTGACACTACTCAATTGATTACAATGAGATAATTGCTTGAAATCAGATGCGTA
TCCAAATGCCAATATGGAATTAAACTTCTTGGAGGTGGAGTTGAGAAATTCAAAGCCTTA
AACAAACCAATTACCATTGAAGCAGCTGATGCATCAACTGAAGCAATCGACGCCATTAAA
ACTCTTGGCGGTCAAGTTAATGTTCTCTATAGAACCCCATTATTGATGAGATATCACATT
AAACCACACAAATTTTCTGATCACAAGACATTGAAGACTCCAATGCCACCTCAAAAGACT
CTTATTAAGCTTGAAAAACTAAGAGATAAGGGACTTAATGTTGAGTATCCAAGAGCACCT
TGGTACACAGACAACAAGGAATCAATTCTTGCCGAAGCCGCTGAAACTGAGAAGAGAATT
AAAAATGCTCAACATGCTCATCTTTTGGAAAAGATTCCAGCAGAAAGAAAAACAGGCTAG
AGCGATGGCATCCCAAGAAAAGAAAAGAAACAATTAGCCAAGTTTATTAAATACATTTGA


>Contig14865.0.1.g43(protein)
MGSMQKKNFVSIAPQGLSEYQLEKKVLMPFTIGNLWDNTGARQQFKRVGRGPGSGLGKTS
GRGNKGMKFRAGGQVNRGFEGGQTNLARRFPKRGIRKNKFNVKQELTQLNLGKLAYFIEK
GLIDTTQLITMRQLLEIRCVSKCQYGIKLLGGGVEKFKALNKPITIEAADASTEAIDAIK
TLGGQVNVLYRTPLLMRYHIKPHKFSDHKTLKTPMPPQKTLIKLEKLRDKGLNVEYPRAP
WYTDNKESILAEAAETEKRIKNAQHAHLLEKIPAERKTGQSDGIPRKEKKQLAKFIKYI