Identifiers and Description

Gene Model Identifier

Contig15485.0.g31

Standard Name

MRPL13

Aliases

Contig15485_0_g31

Description

Ribosomal protein L13

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_012076602.000130478826482e-26Ribosomal protein L13 containi
ng protein
SGDYOR150W2.9990241513684e-21MRPL23 SGDID:S000005676, Chr X
V from 611999-612490, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15485.0.g31(coding)
ATGTTGATAAACACCTTAAGACATCAGTTTAGTTAGGCTTAATTATTTGCCATCGCCAAC
CAGAGAATAACTCTTGGCCTCTTAACTCACCAAGCGCCATTCTTCCAAAAAATTAACAAA
TAAATGCTTGTCTAAACATAAGTTTAGAATTTCTCAACTGACAACAGCAAAAATGAGAAT
AAAAACCCATATACTTTTGAAGAGGATAGAGCTGAGAAACCTTACAGATACCCTCTTGGT
AGCTATAGAATTCCACCTAAGGATGAGATGAAATTTTCTGCATTCGCAAGAAAAGAGAGA
GATTACAGCGTAGATGCAGTTAAACCAGTTTAAGAAATTGATAAGCCATTCGAACCAAAA
GAAGAGTTCACAAGAATGAAATTTGACCCAGATGTAAGATCAATAGTGCCTGAATTTGAA
AATCATGTTCTCTATTAATGGATGGACGGTCAAAAAGCTAAAAGAGATGCAGAAAGTTCT
TATGTAGCAATAAATCACAAGGGTGAGGTATGGCATTTGTTTAACGCTGCAAGAATGCCA
CTTGGTCGTATGGCAGCTTAAATCGCTGTATTTGTTAGAGGAAAGCACAAGCCTCAATAT
ACAATGAACAGGTACGATCTTGGAGATAGAGTTGTTGTAGTGAATGCCTCAAAAGTAATG
GTTACTGGAAAGAAGAAATCATAAAAGCTGTACAGACATCATACCGGTTACGTTGGAGGA
CTCAAGGAAATTGTAATGGAAGACTTAATTGAAAGAGATCCCTGCTAAATTATTCGAAGA
GCTGTAAAGGGTATGCTTCCAAAGAACACTATTAGAGAGATTATGCTTGATCACAATCTC
TTCATTCACGAAGGGCTTTATCACAATCACATAGCATAAAAACTACCTCAATTTGTTGAG
TAAAAGCCAGAGGACATTAACGAGAAAATTAACTTGTTCAGAATGGATAAATCTAAGCTT
GTTGGCATCTATGATAGTGATCCATTAAATCCACCAGAAGAATTCAAAGATGTAAAGAGA
GATATCGATAACGAGATAGATTCACCATTTGGATCAATCAAAAAGACTCATCATATTTCA
AGAAAACAAATTTAGAGTAGCATTAACGTTCAAAGAAGTTTCAGACATCTCAAAAAGTAC
AGACAACACAATTGA


>Contig15485.0.g31(protein)
MLINTLRHQFSQAQLFAIANQRITLGLLTHQAPFFQKINKQMLVQTQVQNFSTDNSKNEN
KNPYTFEEDRAEKPYRYPLGSYRIPPKDEMKFSAFARKERDYSVDAVKPVQEIDKPFEPK
EEFTRMKFDPDVRSIVPEFENHVLYQWMDGQKAKRDAESSYVAINHKGEVWHLFNAARMP
LGRMAAQIAVFVRGKHKPQYTMNRYDLGDRVVVVNASKVMVTGKKKSQKLYRHHTGYVGG
LKEIVMEDLIERDPCQIIRRAVKGMLPKNTIREIMLDHNLFIHEGLYHNHIAQKLPQFVE
QKPEDINEKINLFRMDKSKLVGIYDSDPLNPPEEFKDVKRDIDNEIDSPFGSIKKTHHIS
RKQIQSSINVQRSFRHLKKYRQHN