Identifiers and Description

Gene Model Identifier

Contig13897.0.g86

Standard Name

MRPL12b

Aliases

Contig13897_0_g86

Description

Ribosomal protein L7/L12 C-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00542 ) Ribosomal protein L7/L12 C-terminal domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009185102.0006622580855403e-35Ribosomal protein L7/L12 C-ter
minal domain co...
SGDYGL068W0.0000000000019997478866288316MNP1 SGDID:S000003036, Chr VII
from 375087-375671, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13897.0.g86(coding)
ATGATAGGTGGTGCAGTGCAAACTCTATATCAGAGTTAAAAATAATTACTCACAAAGAAC
GCAGTCATGAGACAAGCCGCTCAAAGAATAGTTTTGAATCAGAACAACAGTCAACTTACA
TCATACAATCACAGATACTTCTCAACTGAAGTAGAGAAAAAGAAGGGTGCATATCAAACA
ACTGCAAACTCATGGGGTACTGAGTGGACTGCTGAATGCTGGAAATTTGAGAAAGAATGG
GAACAAATTGCAGACAAAATCAACGCTGAGAATAAAAAAGAATTGGAAAATGAACTCTCA
CCTGCTCAAGTAGAGAGAGTTAATTTCTTAATGGATTATGTGATGAAATTAAGCAAAGAC
GAGAGATTATACATGAAAATCTTATTAAAGGATAAGTTATTAGCTACTACTAACATGAAT
ATAACCAATCTCAACGTGCAATGGCCCGCTTTCAGAGCTGAAGAGAGAGGAACATGGCCA
GCAAACAACCCTAATTGGTTCTCAGGTTTCGGTTCAGGAGCATCAATGTCAACTGGTGGT
GGTTCATCAGCTACAGCTGCCAAGGATACAAAAGTCGAAGAAGCCAAACCTAAAGAAGAA
GAATAGAAGGAAAAATCTCACTATGATGTTGAATTGACCAAATTTGACCCAGCAAAGAAA
ATCGCTCTCATAAAGGAAGTCCGTGGTATTTTGGCTTTGGGACTGAAAGAAGCCAAGGAA
CTCGTTGAAAGTGCTCCATAGTGGATTAAGAAGGAACTCAAAAAGGAGGAAGCAGAAAAG
TTGGTTGAGAAGCTTAAGGAATTAGGTGCTGAATGTAGACTTGCTTGA


>Contig13897.0.g86(protein)
MIGGAVQTLYQSQKQLLTKNAVMRQAAQRIVLNQNNSQLTSYNHRYFSTEVEKKKGAYQT
TANSWGTEWTAECWKFEKEWEQIADKINAENKKELENELSPAQVERVNFLMDYVMKLSKD
ERLYMKILLKDKLLATTNMNITNLNVQWPAFRAEERGTWPANNPNWFSGFGSGASMSTGG
GSSATAAKDTKVEEAKPKEEEQKEKSHYDVELTKFDPAKKIALIKEVRGILALGLKEAKE
LVESAPQWIKKELKKEEAEKLVEKLKELGAECRLA