Identifiers and Description

Gene Model Identifier

Contig11869.0.g78

Standard Name

MRPL11

Aliases

Contig11869_0_g78

Description

Ribosomal protein L11, N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam03946 ) Ribosomal protein L11, N-terminal domain
  • ( pfam00298 ) Ribosomal protein L11, RNA binding domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005853406.997498932278805e-3050S ribosomal protein
SGDYNL185C4.999723464643358e-28MRPL19 SGDID:S000005129, Chr X
IV from 292669-292193, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11869.0.g78(coding)
ATGAATACAGGCCCAGCCTATAAGGCTCAAGTACGTATTTATTGCAACGCAGGAGTTGCT
AAGCCTTCTCCAAAGATTGGTCAAGCCCTCGGACCCCTCGGTATAAACATGATGCAGTTC
TGTAAAGAATTCAATGAGCGCACTACTATGTACAACACCGAAGTGCCAATGAGAGTTATA
TTGACTGCCTTTGCTGATAGATCATTTAAGTTTGTAGTTAAGCCACCTCCCACCTCATGG
TTCATTAAGAAAGCTGCTGGACTTCCAAAGGGTAGTGATAAAGCAGGTTAAAATGTTGCT
GGTCGTGTTGGAATTAAGTACTTGTACGAAATTGCCAAGGTTAAGCAAGAACTTGATCCA
CACCTAAAGCAACATGATATCGAAGGAATCACAAGAATGGTTCTTGGAAGTGCAAGATCT
ATGGGATTCCAAATCGTTGAAGACACTATGCCACCTGAACCAATTAGAGTTGATATTTGA


>Contig11869.0.g78(protein)
MNTGPAYKAQVRIYCNAGVAKPSPKIGQALGPLGINMMQFCKEFNERTTMYNTEVPMRVI
LTAFADRSFKFVVKPPPTSWFIKKAAGLPKGSDKAGQNVAGRVGIKYLYEIAKVKQELDP
HLKQHDIEGITRMVLGSARSMGFQIVEDTMPPEPIRVDI