Identifiers and Description

Gene Model Identifier

Contig17599.0.g52

Standard Name

MRPL1

Aliases

Contig17599_0_g52

Description

Ribosomal protein L1p/L10e family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00687 ) Ribosomal protein L1p/L10e family

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010542201.9992362000979228e-56L1P family of ribosomal protei
ns containing p...
SGDYDR116C0.000000000010004361180063202MRPL1 SGDID:S000002523, Chr IV
from 683581-682724, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17599.0.g52(coding)
ATGAGATTGCAAGGTAGAATCAATAGGAGATTGAGAAAATACAGGCAAGATAAAATTAAT
AAGGAGTCTTCTTTCAATAAGAACGAAGTTTTGAGTGCCTTCTATCAGAAGAAAGCAACA
ACTCAGGCATCAGTCGAAGGTGAAGAATCCAAGGAAGAAACAGTTGCCGCTATTAATCCC
ATGATAATTAATATGGGTGAGTCTCTGGCTCCCAAAGACGCTCTCTTAAGAATGAAGGAA
GTCTCCAAGCAGAGAAATTTCAAGGAGTCTGTTGAGGCCATATTTAGACTTGCTGTTGAT
CCAAGACAAGGTGATCAAAACATCAGAGGCACATGCATCTTGCCAGCAGGCACAGGAAAG
TCAATTAAAATATGTGTGTTTGCTGACAAATCAATGGAACAAGAAGTTATGGCTGCAGGC
GCAGATTTATTTGGCACAGACGATATATTGAAGCAAATTGGAGAGGGAATAATGAACTTT
GATAAGCTAATTGCCACTCAGGACTAAATGCCTTAACTTAAATCCTTAGCTAGAACGCTT
GGTCCTAAGGGTCTTATGCCTAATGTTAAGAGTGGTACTTTAATTAAGCAAGCTGATCTC
CTTGAAACTGTAAAAGTATCTAAGCAAGGATAAATTGAGTTCAGAGTTAATGAGCACTCA
GACATTATGGTGAAAATAGGTTTGAGAGAATTCGAAGCAGACAACTTAATGCAAAATTTT
GATGCTGTTGCAAAGGCTCTGGTTCTTAAGAAGCCAGAAGCAGTTAAAGGAAAATATTTC
TTAAGAGGTTATATCAAGTCTTCAATGGGACCATCAATTAAGGTAGATTTAGCAGAGTAT
CAAAGACTAGCTTCAGATTGA


>Contig17599.0.g52(protein)
MRLQGRINRRLRKYRQDKINKESSFNKNEVLSAFYQKKATTQASVEGEESKEETVAAINP
MIINMGESLAPKDALLRMKEVSKQRNFKESVEAIFRLAVDPRQGDQNIRGTCILPAGTGK
SIKICVFADKSMEQEVMAAGADLFGTDDILKQIGEGIMNFDKLIATQDQMPQLKSLARTL
GPKGLMPNVKSGTLIKQADLLETVKVSKQGQIEFRVNEHSDIMVKIGLREFEADNLMQNF
DAVAKALVLKKPEAVKGKYFLRGYIKSSMGPSIKVDLAEYQRLASD