Identifiers and Description

Gene Model Identifier

Contig12780.0.g53

Standard Name

MRM1b

Aliases

Contig12780_0_g53

Description

SpoU rRNA Methylase family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00588 ) SpoU rRNA Methylase family
  • ( pfam08032 ) RNA 2'-O ribose methyltransferase substrate binding

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008401501.999002769139511e-37RNA methyltransferase, TrmH fa
mily protein
SGDYOR201C1.000361553249356e-16MRM1 SGDID:S000005727, Chr XV
from 721708-720470, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12780.0.g53(coding)
ATGGAACTAAATGGTGTGGTATCACAGTATAGTCAAAGATTATTTAGTAATGGATATGGC
AATAATAGAGGAAGTTAAGGATAGAATCAAGGATAAAAGCAGCAATATAATAATCAATCA
AATTATTAGTAATAAAGACAATAATAGCAATCTACGAATAGTAGCAGTAGTTCATCCACA
AACTTCACAGCTTCATAATCATCTGGAAATCCCTTGAAGAAAGCTAAACCTGAATACATC
TATGGAATAAACCCTGTGATGGCATGTCTCTCTGCACAGCGAAGATAAATTCAAAAACTG
TATTTAAGCATCACAGAGAAGGGAGGAGAGAATAGAAAGTCACACCCTAAAATTGAGTAG
ATTGCTAAAATGGCATCAAGTTAAGGAATTAAACTCAAGTACTTGCATAAGGTCAAATTA
TCTGGTTTCACAATGTCTAAGCCACATTAGAATGTTGTAATCAAAGCATCAAAGTTAGAA
TATATCAAAATCAGAAAAGACAGTGATATCGAAGCATTAAAAGAACCAAAGAAAGGGCAG
TTTTATCTATTTTTGGATTAAATCACTGATCCTCAAAATTTTGGAAGTATCTTAAGGACT
GCTATGTTCATAGGAGTTGATGGAATAATAGTAAATCAAAACAATGCATGTGGTTTGACT
CCCACTGTGAGTAAAGTGAGTTCTGGTGCCCTGGAATTTATCCCACTCTACTCAACTAAA
TTTGTGAAAAATTTCATGTAAGATGCACAGAAGGGACTCTAGAATTTCAAGATAATCAGC
ACTGACATTGAAAGCTTGGACAGCTTAGATGAGAAAAATTAAGAGAAGGAAGTTGAAGTT
TCAGTCAATTCTGATAGCGACGATGAAAATGAGGGAGCTAGCTCGAAAGGGAAGGGATAG
AAAAAAGACAAATCAAAGCTGAGCTTCCAGCAACCTTCATAAGCACATAACGAAGACGGA
GATAATCATTATCACGAAAAATACGTAGAAGAAGACGTAGATGAGAATATGCCTTTCAAA
ACTAATAAAGTTCTCTCAATTGAAGAGTTACGGTTGAACAAAGACGAGAACATTATCTTG
GTACTTGGATCTGAAGGCGAAGGAGTATCTAAGACTATCAATAAATTGGCCGATTACAGA
GTAATGATTCCACCTCAGTTATGCCCAGAAATGATTGGTAAATATCCATTTAATATGGTA
GATTCTCTAAATGTGGGAGTATCTGCTGGTCTGCTGATTTATCATATTAGATACTTAATG
AGAATGAAGATTTGA


>Contig12780.0.g53(protein)
MELNGVVSQYSQRLFSNGYGNNRGSQGQNQGQKQQYNNQSNYQQQRQQQQSTNSSSSSST
NFTASQSSGNPLKKAKPEYIYGINPVMACLSAQRRQIQKLYLSITEKGGENRKSHPKIEQ
IAKMASSQGIKLKYLHKVKLSGFTMSKPHQNVVIKASKLEYIKIRKDSDIEALKEPKKGQ
FYLFLDQITDPQNFGSILRTAMFIGVDGIIVNQNNACGLTPTVSKVSSGALEFIPLYSTK
FVKNFMQDAQKGLQNFKIISTDIESLDSLDEKNQEKEVEVSVNSDSDDENEGASSKGKGQ
KKDKSKLSFQQPSQAHNEDGDNHYHEKYVEEDVDENMPFKTNKVLSIEELRLNKDENIIL
VLGSEGEGVSKTINKLADYRVMIPPQLCPEMIGKYPFNMVDSLNVGVSAGLLIYHIRYLM
RMKI