Identifiers and Description

Gene Model Identifier

Contig17739.0.g106

Standard Name

MRE11a

Aliases

Contig17739_0_g106

Description

Calcineurin-like phosphoesterase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00149 ) Calcineurin-like phosphoesterase
  • ( pfam04152 ) Mre11 DNA-binding presumed domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007214502.9987670792171964e-67Ser/Thr protein phosphatase fa
mily protein
SGDYMR224C3.000235161122315e-61MRE11 SGDID:S000004837, Chr XI
II from 720653-718575, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17739.0.g106(coding)
ATGGAGCGATCTCAGAACTACAATAACTCAAGCACTAAATCTCAGCATTTGCAGCAACAG
TAAAAGTAACCAGCTTAGATGCCTTTGTAAAAACAGGCAACTGATGATGACTAGGATGTT
TTCAAGATACTGATTACTACAGACAATCATTTGGGATATAAAGAATCAGATAAAACAACA
AGCAATGACTCTTTTTATTCTTTTAATGAGACATTACAAATAGCATGTGACAAGAAAGTT
GATTTTGTACTTTTAGGAGGAGATCTTTTTCATGATTAGAAACCTTCATCTAAAACATAT
TATCGAGCCTCAAAGATCTTCAATAGATATGTGTTCGGTGAACAGAAAGTAAACTTCGAC
ACAATCCAGTATTCCAAGGCAAACTACCTGAATCCCGCACTCTCCGTGAAACTCCCCATT
TTCTCTATACATGGAAATCACGACGACCCCAGTGGATTAGAATTTTTCTCAAGTTTAGAT
CAAGTATGCATCAATCACTACATAAACTACTTTGGCAAGATAAAAAACATAGAGTAGATT
GAAGTTACACCTATATTGTTTACCAAGGGTGTGAGTAAAATTGCATTATATGGAATCGGG
CATATCAAAGATGAGAGACTTAATCTTGCTTTTGAAAATAAAGCCATTAAGTTCAAGAGA
CCACTCTAAGACAGGGATTAATGGTTTAATATTCTAGTTTTACATTAGAATAAGTATAAA
GGTCTTGCCTTAGGCCCTTCAAAACGTTCAAGTATAATGGAAAATTAAATACCTGGCTTC
TTTGACTTAGTCATATGGGCACATGAACATGAAAGTATTCCAAACGTATATGAATGTGAA
GAAACTGGTGTTCATTTCCTACAGCCTGGTAGCACATTCGTATTCAGAACTATTGACCTG
TTTCAAACACAGATTGATCCACGAAGACCTCAACTCATAGAGAATTTTCTCAAGTAAACC
ATTGAAAACATGATTGACTAGGCTTACAAGGATTAGGATACACAAAACACAGACCCATAA
ATGTAGCCAATATATTCTTATGACCCTAGAAAGATTCCAGAAGAACTAAAGCTCCCTTAT
GTCAGATTGAAAGTGGAGTATAGCGGAGGGTATGGGGTTGTTAAGAGCAGGGATCTTAAC
AGTTACTTCGATGGTAAAGTAGCAAACATCAAAGACTACATGTTGTTCTTCAAGCGAGGT
GGATTTGCGGGTGGAAAAGATGGGGAAGGTGGACATGGCAAGTAAAAGTAAGGCAAGAGA
AAGAGTGGAGGTGGCGGTAAAGGTACTGGGTTCAATGAAATGGACGAAGACTTTGATATT
GATGACGAGGAAGATAAGTATGATCACATGGGAAACTTAGATTTCAACAAGTTTCTTATG
AGATAAATCAAAATACGAGATTAGAAGAACCCCAGAGGTATAAAGCTAGATGCCCAGAAG
TTTGTCTCGATTCTTGGTAAAGCCTACGAAACTGATAATATCTCCCTAATTGAGAAAGTT
TACGACAAGGAAATATTCGAGAAAGTTTTCAAAGGAGTAAAACAGCAATTTATCTAAAAC
ATCAAAAGTTAGCTGCCAATTTCTGCTCATGGCTAGAATGAAAATAATAATGCCAATCTA
ATGAGTAATTTGTTCACTGACTTTGCGAAAATGATTATTGATAGTCCATAGGAAATTGAA
GAGAAGATTCAAGCTCTAACCAAAGTAGTCATGAAGGATTTGAACTTAAATGAGGACTAA
GGGGAAGAACATAAAGAAGAGTAAAATTTGAGATAGAAAGATGCATAGAAGGAAGAATTG
AAATATTATGAAAAAGTTAAAGTTCACACACTTTGGGATACAGTTAATAGTAAAGATGAT
AATAGGAAGAGTAGGGATGTTGAGATGTTTCAAGAAACTGATGTATTTGATATAGTCTTC
AATAAAAATGGCGAAGATGTGTAAGTTTAAAGCGCTGCAGTTTCTCAAAATAACAAGAAC
CCAAAAGTTGTAAACAGGAAAGCAAAGAATACTGACTTCGATGAAGACGACAAAAATTAA
AAGAAAAAGTAGCCAAAGAAACAAGCAGTCTCTAAACAGGAACCAAAGTCATCTACAGCT
TAAATAAACCCAAAGATAAACTAGCAAGCTGTTCCTTAAAGTTTACAAATTAAGCAAAAA
CCTGCTTCTGAGAAATAAACTATGAAGCTGAATGAATCCAGAGAGTCACTTCATTTAGAA
GATGGCGATTCATCTGTAAGCGAAGATGAAAAACCTGGATTTGTGAACTTCAATTAAATT
TTCGCCAATGACTTTGATGTAGATGATGCCAGTGAAGTTTAACATATCTAAAAACAAAAA
TACTCTCAAAAGGGGTATCAGGTTAAACCCTCACAGAAAACTTAAAACTCAAAAAATCCA
AAAGATAGCAGCAGTAATAGCAGGTCTCACTCACCAAATCCCAAGAAGAACCCTAGATAA
AATTAAGCCAATAATAAATAGTAGTAGCAGTCTTAACTCACTAGCTTTATATAGAAGAAA
CCAGAACCAAAGAACAACCTTTTGAAGAACTTAAATGACTCAAAATATCTCAGTAAAAAG
AGGAAGAGAGATGAAATAAACGATAATGAGGCTGATAATGACAGTAGTGAAGATGAAAAA
GTAGAAGATTAAAAGAAGAACAATAAGAAGGGTAAAAACAGCAGAAGCAACAGCAGAGCG
AGCGGAAAACAATAGTAATAAAAGAAGAATATCAACCAAAACATTCCTGAATCGATTGAA
GATGATTCTGATAGCAACTACAATCACATCAACCAAAATATTATGAAAAAGCGTAAATTA
AATACTGAATTACAACTTGACAACGATAGTGATGAAATTCAGATAATTTCAAAGAGTAAC
AATGCTGCTCCAAAGAATTTAGGCAACCAGAAAGTTTAAGCTCAGAATAATAACAGTAGT
AGTGGAAGAGCTGCTAGTAAAGGTAAAGGCAAGAAGAAGGATGAGTAGGTTGATGAACAA
GCAACGATGGTGAGTTAGAGCGGAAGAATAATCCCAAATTTCAACAGATACGTCAAAAAG
AAGTGA


>Contig17739.0.g106(protein)
MERSQNYNNSSTKSQHLQQQQKQPAQMPLQKQATDDDQDVFKILITTDNHLGYKESDKTT
SNDSFYSFNETLQIACDKKVDFVLLGGDLFHDQKPSSKTYYRASKIFNRYVFGEQKVNFD
TIQYSKANYLNPALSVKLPIFSIHGNHDDPSGLEFFSSLDQVCINHYINYFGKIKNIEQI
EVTPILFTKGVSKIALYGIGHIKDERLNLAFENKAIKFKRPLQDRDQWFNILVLHQNKYK
GLALGPSKRSSIMENQIPGFFDLVIWAHEHESIPNVYECEETGVHFLQPGSTFVFRTIDL
FQTQIDPRRPQLIENFLKQTIENMIDQAYKDQDTQNTDPQMQPIYSYDPRKIPEELKLPY
VRLKVEYSGGYGVVKSRDLNSYFDGKVANIKDYMLFFKRGGFAGGKDGEGGHGKQKQGKR
KSGGGGKGTGFNEMDEDFDIDDEEDKYDHMGNLDFNKFLMRQIKIRDQKNPRGIKLDAQK
FVSILGKAYETDNISLIEKVYDKEIFEKVFKGVKQQFIQNIKSQLPISAHGQNENNNANL
MSNLFTDFAKMIIDSPQEIEEKIQALTKVVMKDLNLNEDQGEEHKEEQNLRQKDAQKEEL
KYYEKVKVHTLWDTVNSKDDNRKSRDVEMFQETDVFDIVFNKNGEDVQVQSAAVSQNNKN
PKVVNRKAKNTDFDEDDKNQKKKQPKKQAVSKQEPKSSTAQINPKINQQAVPQSLQIKQK
PASEKQTMKLNESRESLHLEDGDSSVSEDEKPGFVNFNQIFANDFDVDDASEVQHIQKQK
YSQKGYQVKPSQKTQNSKNPKDSSSNSRSHSPNPKKNPRQNQANNKQQQQSQLTSFIQKK
PEPKNNLLKNLNDSKYLSKKRKRDEINDNEADNDSSEDEKVEDQKKNNKKGKNSRSNSRA
SGKQQQQKKNINQNIPESIEDDSDSNYNHINQNIMKKRKLNTELQLDNDSDEIQIISKSN
NAAPKNLGNQKVQAQNNNSSSGRAASKGKGKKKDEQVDEQATMVSQSGRIIPNFNRYVKK
K