Identifiers and Description

Gene Model Identifier

Contig21586.0.g100

Standard Name

MPP10

Aliases

Contig21586_0_g100

Description

Mpp10 protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYJR002W9.002093297142233e-23MPP10 SGDID:S000003762, Chr X
from 438865-440646, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21586.0.g100(coding)
ATGGAAAATATTGATATCACATAGCCAGAAAGCCTTGTTAAACAATTGCAAAAAGACCCT
TCATTTATGTATATGGATGATAAAAAATGCAAGTCAAAGCTTTTATCAGTTCTTTAGATT
ATGTTCTAATCTTAAATGAAGAAGCCAGCTCAATAATCTCAATAATTAAGTAGTAAAGTC
CCTCCCAAGATAGTATTCGATGGTTTTGGCTTGGACCAAGTCTGGTCACAGATTGTGCAT
CACACCGAGCACACAAACCAGCAAGTTATAAATAAACTCAGTAATCTCGTCGGCAGAGAT
GATTTCTTGGAGGAATTGGTCTAAGAGATAAAAGAAGAAGAGGAAGTAAGTGATGACTCC
ACTGGGGAAGACGAGGTGAAGAAAGCTAAGAAGAAGAGCAGCAAAAAGAGTAAGAAGCAG
GTGGAGAGTGAAGATGAGGAAGAAGATGGCTTAAAAGCTGATTACGGAGAAGAGGATGAA
GAGCACTAGGATAGAATTTCTGATGAAAATAAGATATTCGATGATGAAGATGAAGAGGAT
GATGAGGACATGAATGAAGATGATGTGCTAGAGAGATACTTGGATGATTAAGATGAGGAA
GAGGAGATGAGAGATGAGATCAAGATACCCTCTGACTTGGAAGATGAGGATGATGACATT
GATGATGAGCTTGGTGGCAGATTAGACGATGAGAATGAAGAATTCGATTAGTTCGCTGAT
GCTTAGGAAGAAGAATTCGACAGAGAGAATGATATCTTCAAGAAGGCAAAAGCTAACGAT
GAGATGGAACTATAAAAGTATGCTGATGAAATCAAGACTCCCGCCAAGAAAGAAGACTTT
GTGAACAAGGACATGATCTCCAGAATTGAGAGACTTGAAGACCAAATGGTTGACAAGAAA
TCTTGGCAAGTTCTTGGAGAAGTCCAGGCCAAAGAGAGACCCATGAACAGTCTTCTGGAA
GTGCATCTAGACTTCAACGTGGCCAGCAAGCTACCACCTCAAGTGACTCAGGAGAAGACT
AACGCCATTGAGACTTTAATCAAACAAAGAATCATGGATGAATTGTTTGATGATCCTTTG
AGGAAGTTTATTGGAGGCAAGGGGAAAGACGATTAGGAAGATTCCCTATTTGATTTCTCA
AAGTCTAAGAAGGGCCTTGGAGAGCAATATGAAGATGATTACAGAAAGAAATTGATAAAT
GCCTCCGCAGACCCAAACGCCTACATGAACTCATCTGAGCTCTTAACTGGTGTTGATTCC
TCCCTTAAAAGAGAAATTAACGACTTAATGAGAGGGTTGTTCAACTAATTAGATCAGTTG
AGCAACTTCAACTTTGTCCCAAGAGTTTCAAACATTAAAGAAGCCACTATCACAACTTAA
AACGTCCCAGCTCTCATGATTGAAGAAGCACTACCAATGAGTGTATCTCAAGCGTAGAGC
AAGACAGCTAGAGAGGTGTTTAGCATCCACGATCAGAAATTGAGAGAAAAGGGTGAACTC
AGCAAGGAAGAAAGAAGAAAGGAGAGAGCCACTAGAAAGAGAAAGATCAAGACTCATTTG
CACAAGAAGGAGATAGGCCAGAAAGAAAAGAGAAGAGACATGGGCATGGGCATGCTAGCT
GACAGATTCGCCATGAAGGATGTTAAGAGAAAGCAGGATAAGAAGAACAAGAAACTCCAA
AAGGAAGGAGCAGTTGATGAGAGCGCTGTCACAAAGAAATCAGGCAGCAAGAACGAAATG
AAGAGTAGCAAGTTCTTCAAGCGCCTTGAGGAGGTTGTCAAGACTGATGCTGCCAAGAAA
GAATCCAAGAAGAGACAAAAGCTAGAGAACACTAATAGTACTTATGTCAATCACGATAAT
AAACCAACCAAGAGATTTAAACTTTGA


>Contig21586.0.g100(protein)
MENIDITQPESLVKQLQKDPSFMYMDDKKCKSKLLSVLQIMFQSQMKKPAQQSQQLSSKV
PPKIVFDGFGLDQVWSQIVHHTEHTNQQVINKLSNLVGRDDFLEELVQEIKEEEEVSDDS
TGEDEVKKAKKKSSKKSKKQVESEDEEEDGLKADYGEEDEEHQDRISDENKIFDDEDEED
DEDMNEDDVLERYLDDQDEEEEMRDEIKIPSDLEDEDDDIDDELGGRLDDENEEFDQFAD
AQEEEFDRENDIFKKAKANDEMELQKYADEIKTPAKKEDFVNKDMISRIERLEDQMVDKK
SWQVLGEVQAKERPMNSLLEVHLDFNVASKLPPQVTQEKTNAIETLIKQRIMDELFDDPL
RKFIGGKGKDDQEDSLFDFSKSKKGLGEQYEDDYRKKLINASADPNAYMNSSELLTGVDS
SLKREINDLMRGLFNQLDQLSNFNFVPRVSNIKEATITTQNVPALMIEEALPMSVSQAQS
KTAREVFSIHDQKLREKGELSKEERRKERATRKRKIKTHLHKKEIGQKEKRRDMGMGMLA
DRFAMKDVKRKQDKKNKKLQKEGAVDESAVTKKSGSKNEMKSSKFFKRLEEVVKTDAAKK
ESKKRQKLENTNSTYVNHDNKPTKRFKL