Identifiers and Description

Gene Model Identifier

Contig14802.0.g27

Standard Name

MOZ

Aliases

Contig14802_0_g27

Description

PHD-finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002418402.9993110246221282e-28PHD-finger family protein
SGDYJR119C0.00000000039982266684865623JHD2 SGDID:S000003880, Chr X f
rom 646490-644304, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14802.0.g27(coding)
ATGAAGCCCACCTTTTTAGAGAAGTTTGGTAAAATCTACACATACCCCTATGGAAACTCG
TTTATGCAGGATCCCGTTTAGTAAAATATTGAATAACAAGAATTTGAGAGATATGTTCAG
AAAAAGCGCAATTTTAGACCATTCCATATGGAGTGCAAGGTGACAAAGAGAAGGTTGTGC
TACTGCCCAAATAGCAGTGTTCTCACTGAGTAGTCGAAAGTATAAATGCAACTATAGCAA
AATGTGGCAGCTGATTTGGTTTCGTACTTTGAAGGATACCCAGTTGATTTTGAAACTAAA
ATGAAGAATAAGCTATTGATGGAGAAAGAAAGATTGATGCATGTTTAAAAAGAAGATTTT
GCTGATACTTTTGAGAAGTATTTAGATTATTTAGATGAAGACGACTTGAAAGATTTTGAT
ACACAGATGAAAAGCTAGAGGAAAGAATGCAGTTACTGCAAATAAACAATCTATGATAAT
ACTGTGACACAAAGCTGGAAGTCTGAAAAAGGTGACCAAGTTCTTCTCTGTTCTAAATGC
AGCTAGAACTATATTTCGGGTCTTATTGATCCGGGTTCAGAAAATAAAAAGGTAGCAAGG
TATATTGCCACATCTATAAATGCAGCTAAAACAGGTAAACCAACTTAACTACCAACCAAA
CCAGGTTAACAATAAATCCCCAACAAACCCTAGACATCTGGATAAAATTCATCGAATTTA
AAGAGCTCAGCAAAGAAAGCAAATACCAATGGAAAGGGAGAAGGATTAGACATTTGTTCA
CTATGTGAAAAGAAAGTGATTCCCAGCGAAGAAGCGAAGAGCTTGAAATGTTTCAGATGC
TTGAAAATGTATCATAGCACCTGTCATTAACCACCACTCAACACTGAGTTGGTGAAGCGA
TTCTAATGGGAGTGCTCTGATTGTAAAACTTGCAAAAACTGCAACTAAAACAATGATGAA
GACAAGATCATTATTTGCGATATGTGTGACAAAGCAGTTCACATCCATTGCTTGAACCCT
CCATTGTTCTAAATACCTTCTCACAACTGGTTCTGCAAAGACTGTGTGAATTGTCTTTCT
TGCGATAAAGAGCTTGGTCCTATTTCCCAAAAGTCTCAAGGTCTCTGGTGTGAAGGCATC
TATAGAATGTGCAAAGACTGCAATTACTAGCTACAACAAGGAAATTTCTGCAAAGTATGC
AGAAAATCATACTCCTAAGACTCCAATGAGGATTTTATTCAATGTGACGAGTGCTAAGAT
TGGATACATGCTGCTTGTGACGGTTTTGACAGTGAAAAATTAGCCAAAATGAAGGATGAT
GAGAAATACAGTTGTCCTATTTGCAAGAAATCGAAGGATGGTAAGTCAATTGGAAATGGC
ACTGCTGGAACTGCTTAAGTTTCTCAATAAAGAAAGAGATGA


>Contig14802.0.g27(protein)
MKPTFLEKFGKIYTYPYGNSFMQDPVQQNIEQQEFERYVQKKRNFRPFHMECKVTKRRLC
YCPNSSVLTEQSKVQMQLQQNVAADLVSYFEGYPVDFETKMKNKLLMEKERLMHVQKEDF
ADTFEKYLDYLDEDDLKDFDTQMKSQRKECSYCKQTIYDNTVTQSWKSEKGDQVLLCSKC
SQNYISGLIDPGSENKKVARYIATSINAAKTGKPTQLPTKPGQQQIPNKPQTSGQNSSNL
KSSAKKANTNGKGEGLDICSLCEKKVIPSEEAKSLKCFRCLKMYHSTCHQPPLNTELVKR
FQWECSDCKTCKNCNQNNDEDKIIICDMCDKAVHIHCLNPPLFQIPSHNWFCKDCVNCLS
CDKELGPISQKSQGLWCEGIYRMCKDCNYQLQQGNFCKVCRKSYSQDSNEDFIQCDECQD
WIHAACDGFDSEKLAKMKDDEKYSCPICKKSKDGKSIGNGTAGTAQVSQQRKR