Identifiers and Description

Gene Model Identifier

Contig3360.0.g45

Standard Name

MOS11c

Aliases

Contig3360_0_g45

Description

XdhC Rossmann domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam13478 ) XdhC Rossmann domain
  • ( pfam12782 ) Invertebrate innate immunity transcript family
  • ( pfam08123 ) Histone methylation protein DOT1

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3360.0.g45(coding)
ATGGATGGCTTGTTTAACTAATTGTCTTCTCATGAAATTTCTTCTCCTACCTCACTGACA
GATGCTGAAAAACGAAAGCTTAGACTTCAGAGATTTGGAAACTCAAACGCATAAAACCCC
AACCTGACAACCCAAGACGCTTTAAAAATGTAGAATGAGGAACTATAAAAACGCCTAGAG
AGAGCTAAGAAATTTGGATTGGAGGATAGTAGCAAAGATTGTTAGAAATTAAAGCTTCAA
TAGAGAGCTGAGAGATTTGGCATAAAGTAAGGGAAAACTAAGCATATTTCTAAAAACAAT
GCAACTATTAGTAATAATGGTACAAATGACTTATCTAAAAATAGAAGCATAATCTTAAAT
CATAAAGATGATTGTGACTCAGATTAACATAAAGCTTTACTTGAGAAGAGAAAAGAAAGA
TTTGGCATTGTCACATAGAAAGATTAAAAGAAACAAGAATTAGAAAATAAATTAAAGCGA
AAGGAAAGGTTTTAAAAGGATTAGACTAGCACAACATTTAGTAGCAATAGAACAGTAATA
AAAAGAGTTAACGCTTGA


>Contig3360.0.g45(protein)
MDGLFNQLSSHEISSPTSLTDAEKRKLRLQRFGNSNAQNPNLTTQDALKMQNEELQKRLE
RAKKFGLEDSSKDCQKLKLQQRAERFGIKQGKTKHISKNNATISNNGTNDLSKNRSIILN
HKDDCDSDQHKALLEKRKERFGIVTQKDQKKQELENKLKRKERFQKDQTSTTFSSNRTVI
KRVNA