Identifiers and Description

Gene Model Identifier

Contig14790.0.g112

Standard Name

MORN1k

Aliases

Contig14790_0_g112

Description

PRP38 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007328903.999031314999233e-77hypothetical protein
SGDYGR075C0.0004999512321494991PRP38 SGDID:S000003307, Chr VI
I from 636875-636147, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14790.0.g112(coding)
ATGAAAAAGGGTCAAGCTCCTCCACCATAACCAGAGCCAACTCAAGAAAAAGAAGAAATT
AAAGAAGTTCCATAATCTGGCATTGGTAGATTTGAATACATTAATGGGACTATGTATGTT
GGCAATTGGAAGCTTTCTAGTGGCGTTAAAGTGAAGAATGGTCATGGGAAAATTACTTTC
TCAGGCACAACTGCTAGTGAATTTGGTAACGAAGAATATGAAGGTGATTGGGAAGAGGAC
CTTATGCATGGATATGGAACCTACAAATATACTTCAGGCGCTGAATACTCTGGCTAATGG
TCAAAGGGAAAGTAGCATGGCATTGGGACTATGTAGTATGCAGATGGGTCAAAGTACGAA
GGTTGCTGGGAAAATAATTTAATGCATGGTGATGGTGTATACACTGACTCCGATCAAGTA
AGATGGGAAGGCATTTTCGTTAATGGTACTTTCGAATCAAAGATCCAAAAAAAACTACAA
GCTGAGAAAATCCTAAAAGAAAAGCGCAAGGCCTACGAAGAGAAGGCTAAAGAGTTTTTT
ACCAAGTTTTTGGAGGCTTTCGCAAAATCAGACAAGAAAACTTTCAAAGATAATTTAACA
CCCTTCTTTGCAACCGTCGATCATGTTCAAGAATTTGTAAGTGATCCTTATCCTAAATTT
GAGGAAAAGCAACCAGACAAATGGAATGACTGGATTAAGACTATTTACAGTGATGGTAAA
TGCAAAATCAAGGCCTTAGGCAGCAAAGAGGAATCCACATTAATTCCATAAGGTAATATT
CAGGCTGAGCAACTCAGAGAAAAACCAGGAGGTCAACTTGTTGAAGTTGTCACTCAAGTT
AACGATAAAAACTTTGTCAGTGTTTTATGTGAATTGCCTAATGAAAATTGGGTATTAGTA
ACTGATCCAAGAGCACACTAAGTGCATGGAACTAATCCCCAATTTCTGATTGATAAAATT
ATCAGATTAAAGATCCATAACGACCCTTATTACAAAGAAAAGTGTTTCGCTTTGACTGCT
GAAACTCTTGTAGATAGAGCAATTGAACTAAAATATGTAGGGGGGACTTATGGAGGAGTG
AGAAGACCATCAAAATTTCTCTGCTTAATCTTGAAAATGCTGCAGATTCAACCAGACACC
GATATTATTTTGGAATTCATTAAGAACGAAGACTATAAGTACATCCGTGCTCTGGGTGCC
TTCTATTGGAGACTTACTGCCTAAGGAAAAGATGTGTATAAAGTGCTGGAACCATTGTAT
AAAGATTATCGTAGAATCGCTTTTCGCAAGGAAGAAGGTCGGTTTGAAGTAATGCACATC
GATGAATACATAGACCACTTGATAAGAGATGAGATTTTTTGTGAGGTTCAACTCCCAAGA
ATCAATAAGAGATATGTATTTGAGGAAGACGGCTTGCTTGAACCTAGAATCAGCACTTTA
AGTCTACAAGCTTAAGATTAAGAAATCGAAGAAGAGGAGGAATAGACTGTATAGGAACCT
AAAATAGATGAAAACAAAATGTATATGGAAGAGATGAAAGCAAAGGAGAAGCAATACTAA
GGAAGCAGCAGAGATAAAATTAATGAAGATAGAGGAAAGAGTGGAATAAATATTAATAGA
GGGAACTTCTCACCTTACAGATCTAGTTCAGGATCAAAGTCGAGATCAAATAGCAAGGAT
AAGATTAAAGAACAATAAAAAGACAAGAGAAGGTCACCATCATCATCAAAAGAAAAAGAT
AGAAAGAATAGGAAGTATGATGATAAATCAAGGAAATCAGGTAAAAGATATAGCTCCTCA
TCAAGCAGTGAAAGGTACAGAAGAGATAGAAAAAGAGATGAAAAAGATAAATACAAGTAA
GAGAATGATAAGTATAAAAAGAGCAATACTACTTAATCTAAGATTAATGATGGAAAATAA
GTAGATACGACTAGTGATGAATATTGGCTTGAAATGAGGAAGAAAATGGGATTAAAATGA


>Contig14790.0.g112(protein)
MKKGQAPPPQPEPTQEKEEIKEVPQSGIGRFEYINGTMYVGNWKLSSGVKVKNGHGKITF
SGTTASEFGNEEYEGDWEEDLMHGYGTYKYTSGAEYSGQWSKGKQHGIGTMQYADGSKYE
GCWENNLMHGDGVYTDSDQVRWEGIFVNGTFESKIQKKLQAEKILKEKRKAYEEKAKEFF
TKFLEAFAKSDKKTFKDNLTPFFATVDHVQEFVSDPYPKFEEKQPDKWNDWIKTIYSDGK
CKIKALGSKEESTLIPQGNIQAEQLREKPGGQLVEVVTQVNDKNFVSVLCELPNENWVLV
TDPRAHQVHGTNPQFLIDKIIRLKIHNDPYYKEKCFALTAETLVDRAIELKYVGGTYGGV
RRPSKFLCLILKMLQIQPDTDIILEFIKNEDYKYIRALGAFYWRLTAQGKDVYKVLEPLY
KDYRRIAFRKEEGRFEVMHIDEYIDHLIRDEIFCEVQLPRINKRYVFEEDGLLEPRISTL
SLQAQDQEIEEEEEQTVQEPKIDENKMYMEEMKAKEKQYQGSSRDKINEDRGKSGININR
GNFSPYRSSSGSKSRSNSKDKIKEQQKDKRRSPSSSKEKDRKNRKYDDKSRKSGKRYSSS
SSSERYRRDRKRDEKDKYKQENDKYKKSNTTQSKINDGKQVDTTSDEYWLEMRKKMGLK