Identifiers and Description

Gene Model Identifier

Contig467.1.g40

Standard Name

MORN1ca

Aliases

Contig467_1_g40

Description

MORN repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

  • proteasome core complex, alpha-subunit complex (IEA) | GO:0019773

Molecular Function

Biological Process

  • ubiquitin-dependent protein catabolic process (IEA) | GO:0006511

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005901304.9986056260133516e-43hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig467.1.g40(coding)
ATGGATGAAGCAAAAAATATTACACAAGTCAAGCCCTCCAAATTTATGTATGATTAGCCT
TTATCCCCAAGCAATAGAGATTTAATTGAGCGTGGCCCTTAAGAGCTTGAGGACGGAGCT
GTATATACTGGGGAGTGGACTAAAAATGGCTTGAGACAAGGAAAAGGTGAATAAACAAAT
AAGGATGGTTCATATTACAAAGGGTACTGGAAAAATAACAACATGCATGGAAAAGGAGTC
TTAATTTATAGTGATGGCCGTAAATATGAGGGAAAATGGTAAAATAACTAAATGCATGAT
CTTGGTACATTTACTTGGCCTGATGGTCGTATATACATTGGATAATACGTAGACGGAAAA
AAGGAAGGATTTGGTGAATTTAAATGGCCAGATGGGAGACTTTACTAAGGTGATTGGTTA
AATGGCAAATAGCACGGAAAGGCAATCTATACAACCAGTCAAGGATTAGAAAAATATGGA
GAGTGGGAAGAAGGAAAAAGAATCAGGTGGCTGGGAAAAGGACAAATAGATTGA


>Contig467.1.g40(protein)
MDEAKNITQVKPSKFMYDQPLSPSNRDLIERGPQELEDGAVYTGEWTKNGLRQGKGEQTN
KDGSYYKGYWKNNNMHGKGVLIYSDGRKYEGKWQNNQMHDLGTFTWPDGRIYIGQYVDGK
KEGFGEFKWPDGRLYQGDWLNGKQHGKAIYTTSQGLEKYGEWEEGKRIRWLGKGQID