Identifiers and Description

Gene Model Identifier

Contig9137.0.g85

Standard Name

MORN1bx

Aliases

Contig9137_0_g85

Description

MORN repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011641301.000296925633081e-74hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9137.0.g85(coding)
ATGGGAATTTGTTGTTCAACGAACTCTTCACTTAATAATCCAGAAGTCAACCAGAATAAA
AATATAAAGAAGCAAGAAGGGTCAGAATTCAACAATAATAACATTAATGGCTAATAATTG
ATGATGTAGGGGCCTATAGTGGATTTTAAGAAGGCGAATTTATCATCATAACCTGACAGC
GGCAGTACTAATTTATCGGCAGTTAATGATAATTCAATCAGTGAGCAATAGAAATCTGAG
AAATTATATAAGCGATTGGTGATAGACTGGCAGGAAGAAATAATATAGAATAGATTGAAT
TATGCACCTGCTCACATTGCTAATGATGGTTCCACTTATAGAGGTTACTTGTAGAATTTT
CAGAGATATGGTCCAGGTACTTAAATATGGGATGATGGAAGCATCTACGTAGGTGAGTGG
CGTGACGATAAAAGAAACGGTTTAGGGAAGTTAGTAACTGCCTCAGGAGATATATACGAA
GGGTTCTGGAAGAACGACAAAGCAAACGGAAAAGGGAATTATTACTATCAGAATGGCAGC
ACATTTTCAGGATATTGGTTGGACGATCTATAGGAAGGAGAGGGTAACGAGAGATGGCCA
GATGGTGCTATTTATAGTGGTAGTTATAGAAATGGCATGAAAAATGGACTGGGAAAGTTT
GTGTGGCCCAACGGAAGTGAATATGATGGGGAATTCAGCGATAATTCTATATGTGGAAGA
GGTACTTACATTTGGAATAATGGAAAGAGATTCACTGGAGAGTGGAAAAATAACTTGATG
GAGGGTAAAGGAGTGTTCGATTGGCCTAATGGAAAGAAATACGAGGGCTAATACTTTTAA
GACAAGCGTTAAGGATGGGGAAAGTTCTATTGGCCAGATGGAAGAACCTACGAAGGTGAA
TTTTGGAAAGGCAAGCAACACGGTCGCGGGTATTACATAAACGAAAATGGAGACATATTT
TTGGAGGAATGGAGACACGGCCAGAAGATCAGACAGTAGCAAGTTGACAAGATGGAGGAT
GTTAATTAGAGTAATTATAAGTATTGA


>Contig9137.0.g85(protein)
MGICCSTNSSLNNPEVNQNKNIKKQEGSEFNNNNINGQQLMMQGPIVDFKKANLSSQPDS
GSTNLSAVNDNSISEQQKSEKLYKRLVIDWQEEIIQNRLNYAPAHIANDGSTYRGYLQNF
QRYGPGTQIWDDGSIYVGEWRDDKRNGLGKLVTASGDIYEGFWKNDKANGKGNYYYQNGS
TFSGYWLDDLQEGEGNERWPDGAIYSGSYRNGMKNGLGKFVWPNGSEYDGEFSDNSICGR
GTYIWNNGKRFTGEWKNNLMEGKGVFDWPNGKKYEGQYFQDKRQGWGKFYWPDGRTYEGE
FWKGKQHGRGYYINENGDIFLEEWRHGQKIRQQQVDKMEDVNQSNYKY