Identifiers and Description

Gene Model Identifier

Contig494.1.g79

Standard Name

MORN1bt

Aliases

Contig494_1_g79

Description

MORN repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam02493 ) MORN repeat
  • ( pfam05611 ) Caenorhabditis elegans protein of unknown function (DUF780)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008252405.999266750653237e-78hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig494.1.g79(coding)
ATGGGTGCTGTCTGCTGCAAGTCTTAAGATACAAGTATCGGTCTAGATTTATAAAATTCT
GTGACAAAGAGAAAAGAAGACGAAAGTGATAATTAAATCATCGATTAATCAACAACTATC
TCAAACACTGAAGTGCCAAAAGATTTTGTGTTCGAACATAATGAAGTTTACTAAAAAGTT
TATAATGAATGGAAGGAGAGAATAGTTCAGGAAAATCTCGAATATACTCCATTTTTCGTG
TTCAAAACTGAAAAAGAAGAGACAAGATATAAGGGTTACCTGAATTAAAAAAAAGAGAGA
CATGGGCCTGGCAGTGAGCTGTGGGAAAACGGTTCGTTCTATCATGGAAGTTATTTGAAT
GACATAGTATTTAGCTATGGACTTCTTCATCACAGTGATGGTGCTACCTATCTTGGATAA
TGGGCAAATGGCTAGTCTAATGGATATGGAATTTACACTCATCCTCATGGAGCCAAGTAT
GTGGGCTTCTGGCATAATGATAGATAACACGGAAGGGGCTTGGAAACTTGGCCAGATGGC
GCTGTGTTCAAAGGTGTCTATAAAAATGGTAAGAAACATGGAATAGGCAAATTTAAATGG
GCAGACGAATCTTAATACGAAGGTGAATTCGAGGACAACAACATCAGCGGTAAGGGTGTG
TATAAATGGAAAGATGGACGCTAATACGAGGGCACATGGCGCGAAAACTTAATGCATGGC
AAAGGAGCTTACACTTGGGCTGATGGACGTAAGTACGAAGGAGAGTACTAGAATGAAAAG
AAACAAGGGTTTGGAACCTTTTCTTGGCCAGATGGAAAGATATATTCAGGTAAATGGGAA
AATGGAAAACAACATGGAGAAGGCGAATTTACAACGAGCTCTGGTTTGGTTAAAAAAGGA
ATCTGGGCAGATGGCAAGAGAATAGAATGGCTGTGA


>Contig494.1.g79(protein)
MGAVCCKSQDTSIGLDLQNSVTKRKEDESDNQIIDQSTTISNTEVPKDFVFEHNEVYQKV
YNEWKERIVQENLEYTPFFVFKTEKEETRYKGYLNQKKERHGPGSELWENGSFYHGSYLN
DIVFSYGLLHHSDGATYLGQWANGQSNGYGIYTHPHGAKYVGFWHNDRQHGRGLETWPDG
AVFKGVYKNGKKHGIGKFKWADESQYEGEFEDNNISGKGVYKWKDGRQYEGTWRENLMHG
KGAYTWADGRKYEGEYQNEKKQGFGTFSWPDGKIYSGKWENGKQHGEGEFTTSSGLVKKG
IWADGKRIEWL