Identifiers and Description

Gene Model Identifier

Contig1068.0.0.g83

Standard Name

MORN1br

Aliases

Contig1068_0_0_g83

Description

MORN repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_012488705.99792543404391e-93hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1068.0.0.g83(coding)
ATGCTCCAAATCAAAGTGGCTTTGTGTTGCCCAAAGCAGTAATTCCCCTCGGTCTAATTA
GAAAATGGAGCTGTTTACACCGGTGAATGGGCAAGAGGAATGAGAGAGGGTTAGGGATAT
TAAGAATGGCCAGATGGTTCAAGATATATAGGAGAGTGGAAGAATGATAAAGCTAATGGT
TATGGAAAATTGTTTCATGCTGATGGAGATGTGTACGAGGGAGAGTGGATAGACGACTAA
GCTCACGGTCAAGGAAAGTACATTCATAGCAATGGAGCAGTCTATGAAGGAGAATGGATC
AATGATAAACAAGAGGGATATGGAGTGGAGATATGGCCAGATGGGGCAAGGTATGAGGGC
ATGTTCAAAGACGGCAAGAAAGAAAATATGGGAGTTTTGAAATTTGCAGATGGCTCGATA
TTCCAAGGCTCTTTTGGTGATAATGAAATAAATGGTACTGGCACTTACATTTGGGGAGAT
GGAAAAGTTTATGTTGGTGAATGGATCTCTAATAAAATGCATGGAAAAGGATCTTTGAAA
TGGCCAAACGGAAAGTAATATGATGGAGAATTTAAAGATGACAAACGACATGGCCATGGA
GTTTTTATCTGGAGTGACGGTCGAATGTACGATGGAATGTGGAAGAATGGCAAGCAGCAT
GGCAGAGGAGTATTCAAACAAATAGATGGCTTGGAGCTCGTGGGTGAATGGAATGAAGGG
GAGAGAACAAGATGGCTTAATGGAGGAGGAAATAGTGGACATGAAAATGTTAATGCGAAA
GCGTCCTCATCAATATGGTCTCATTAAAGTAAACAGAGTGTCAAGTAGCATTGA


>Contig1068.0.0.g83(protein)
MLQIKVALCCPKQQFPSVQLENGAVYTGEWARGMREGQGYQEWPDGSRYIGEWKNDKANG
YGKLFHADGDVYEGEWIDDQAHGQGKYIHSNGAVYEGEWINDKQEGYGVEIWPDGARYEG
MFKDGKKENMGVLKFADGSIFQGSFGDNEINGTGTYIWGDGKVYVGEWISNKMHGKGSLK
WPNGKQYDGEFKDDKRHGHGVFIWSDGRMYDGMWKNGKQHGRGVFKQIDGLELVGEWNEG
ERTRWLNGGGNSGHENVNAKASSSIWSHQSKQSVKQH