Identifiers and Description

Gene Model Identifier

Contig19473.0.g10

Standard Name

MORN1bp

Aliases

Contig19473_0_g10

Description

MORN repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000789402.999180586171967e-98hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19473.0.g10(coding)
ATGGGAGCAAATTGCACAACTTGTCAGTCTTGCAATGCCGAGAGCGAGTTCAATGATAAC
ACAGCCATTGACCCCAGGTAGAGCGTCACTGCCATATAAACATAAAATAAGGGATATATA
TCAAAGACAAACTCTAAATATTAAGGAGACCTACACTATAAAATGCATGTGAAGAAACTT
ATCAAGATTCAGGCACTATATAGAGCAATTAAGGCCAGGAAGATGTTTGAGATGCTTCAA
CTGTAAACTAAGGTAGTGAGCAAATACTTTACTGATGATGAAGTGCGTGAGACACTCTAC
GGAGTGTTCAAACCAAAGCAAAAGCTAATGGTGAAGACATACAAATATAAAAATAATTCT
GTGTACAACGGCGAGTGGCTTGGTGGCTTCAGACATGGAAAGGGTATCATGAAGTGGCCA
GATGGTGCTGTATATGAAGGGGAGTGGAACTACGGACACGCCTTTGGCGATGGCAAATTT
CATCATGTTGATGGTGACGTATACGAAGGACAGTGGTCTAACAACAAGGCTAATGGTTAT
GGCTTCTATACAAATGTAAAAGGAGCTAAGTATGAAGGATACTGGAAGGACGATTAACAA
CATGGAAAGGGAATTGAAACCTGGCATGAAGGCAGTAAATATGAAGGTATGTATGCTAAC
GGAAAGAAAGAAGGTTTTGGAAAATACTAATGGGCAGATGGTAGTGTATATGAAGGTGAG
TGGTTAGACAACAGAATAAATGGCAAGGGTGTCTATCTATGGAAAGACGGCAGAAAATAC
TATGGTGAATGGGCCAATAATGATATGGAGGGAGTTGGTGTTTATTTCTGGGCTGATGGG
AGACGCTACGAAGGTCAGTATTAGAATGATAAAAAGTGTGGGTATGGTTTATACTACTGG
ACAGATGGTCGTAAATATGAAGGCTGGTGGTACAAGGGCAAACAGCATGGCCTTGGAACT
TATGTAGATCCAGCTAAGGGTAAAATGAAATATGGGTTATGGGAAAACGGTAAAAGAGTG
AAATGGTTTGATGAGCAATCGATTAAATTGATTAATTAGAGAACATTTGACTATACAACT
TCATTCACTGAAGAGGAGAGTGCCAATCATGTCAGAGCCAACAGCACATTTTTAAAACCA
GAAGACCTTGATTTTCACATTAATAAAATTAAGAGAGAACTTAGAGTTCCCAACAGCACA
CCTTGA


>Contig19473.0.g10(protein)
MGANCTTCQSCNAESEFNDNTAIDPRQSVTAIQTQNKGYISKTNSKYQGDLHYKMHVKKL
IKIQALYRAIKARKMFEMLQLQTKVVSKYFTDDEVRETLYGVFKPKQKLMVKTYKYKNNS
VYNGEWLGGFRHGKGIMKWPDGAVYEGEWNYGHAFGDGKFHHVDGDVYEGQWSNNKANGY
GFYTNVKGAKYEGYWKDDQQHGKGIETWHEGSKYEGMYANGKKEGFGKYQWADGSVYEGE
WLDNRINGKGVYLWKDGRKYYGEWANNDMEGVGVYFWADGRRYEGQYQNDKKCGYGLYYW
TDGRKYEGWWYKGKQHGLGTYVDPAKGKMKYGLWENGKRVKWFDEQSIKLINQRTFDYTT
SFTEEESANHVRANSTFLKPEDLDFHINKIKRELRVPNSTP