Identifiers and Description

Gene Model Identifier

Contig12162.0.g87

Standard Name

MORN1bn

Aliases

Contig12162_0_g87

Description

MORN repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam02493 ) MORN repeat
  • ( pfam09580 ) Sporulation lipoprotein YhcN/YlaJ (Spore YhcN YlaJ)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_012488706.002009875581486e-101hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12162.0.g87(coding)
ATGGGAAATTGTGCTGGCTATTGCACTGGATGCAAAGACGAAAATTAACAACGATATGAC
AATAATTAAGTGCGTAATTCATTAATGGAAAAAGATCGAATAGTAGGAGAAGAATTTGGA
GGGGAGAGATATTCTGGTCACGCTGAATATAACAACAATGGTTAATAAAAATAGCAATAT
AGTAACCAATAGGAATAGATAGGAAATTATGCAGCCTCAAATCAGCATGGCAGTAGTTAA
CTCAAATAACTCAAGAAACCTAATAAAGATTAACAGTATTCCCAGAATCAATAGCAAAGA
GCTTCAGATTTCTTATATGAATCAGGGATGGCAATACCTCAAGGAGGGGGACTTACTTAA
TCTTAAGAAGGCCTTGAGGTCATTGATGATCAGGGGAGGATATAGATGGGGCCAATTACT
CTGAAAAATAATGCAGTTTACACTGGTTAATGGTTGAATAACATGAGAGATGGATAAGGG
AGCCAACTTTGGCCTGATGGCTCACACTATGAAGGGGAATGGCGAAATGACAAAGCTAAT
GGCTTTGGGAAGTTAGAGCATGCAGACGGAGACGTGTACGAGGGTGAATGGCGAGATGAC
AAAGCGCACGGAAAAGGAACTTATTCGCATGCAAATGGTGCTTATTACAATGGAGAATGG
ATCGATGATAAACAGCACGGACTTGGAATGGAAAGTTGGCCAGATGGAGCAAAGTACGAA
GGGCAGTATAGGGACGGCAAGAAAGATGGCAAAGGAAAGTTAACATTTGCTGATGGATCG
TACTATGAGGGAGAATTTAAGTCAAATGAGATAAATGGCACAGGAAAATACTATTGGCCT
GATGGGAAATTCTATGATGGTCAGTGGCTCAAGAATAAAATGCACGGCAGAGGACTATTA
ATATGGAAAGACGGGAAAAGGTACGATGGCGATTTCGTAAATGACAAACGTGAAGGTCAA
GGCACTTTCAGTTGGACAGACGGTCGTTAGTATGTAGGATAATGGAGACAAGGCAAATAA
CATGGCAATGGAGTTTACATCAGTAAAGAAGGCTAGAGAAAGGTTGGAGAATGGAATAAT
GGTAAGAAAATATAATGGTTAGAAGGCGATGATGGAAATAGCGATGGTGGAAATGAAGGG
AACTGA


>Contig12162.0.g87(protein)
MGNCAGYCTGCKDENQQRYDNNQVRNSLMEKDRIVGEEFGGERYSGHAEYNNNGQQKQQY
SNQQEQIGNYAASNQHGSSQLKQLKKPNKDQQYSQNQQQRASDFLYESGMAIPQGGGLTQ
SQEGLEVIDDQGRIQMGPITLKNNAVYTGQWLNNMRDGQGSQLWPDGSHYEGEWRNDKAN
GFGKLEHADGDVYEGEWRDDKAHGKGTYSHANGAYYNGEWIDDKQHGLGMESWPDGAKYE
GQYRDGKKDGKGKLTFADGSYYEGEFKSNEINGTGKYYWPDGKFYDGQWLKNKMHGRGLL
IWKDGKRYDGDFVNDKREGQGTFSWTDGRQYVGQWRQGKQHGNGVYISKEGQRKVGEWNN
GKKIQWLEGDDGNSDGGNEGN