Identifiers and Description

Gene Model Identifier

Contig1240.1.g132

Standard Name

MORN1bh

Aliases

Contig1240_1_g132

Description

MORN repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010936503.998604088504543e-111hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1240.1.g132(coding)
ATGTTGAGTCAAATGACTGGGCAAGCGAATCACTTAGAATATGAATCAATAGTATTAGAG
ACTCATGAGTTTGATTTAGATATGCTAAGAGAACTGCCTAACTATGTGTAGAGAAAGTAT
CCTGATGCTATCTATATGGGACAATTCTCAAATGGAAAAAGAAACGGCAGAGGAGTGATG
AGATACAAAAATGGTAGATAATACGAGGGTGACTGGGAAAGCGACCTCAGAAATGGCAAG
GGTTTTGAGCGTTACCCTAATGGAAACTCCTATTTCGGTCATTTTATGAGGGGGAAAGCT
CATGGAAAAGGTGTTTACTCATGGAGCAATGGGGAAGTGTACGATGGTGAGTGGGATTAA
GGACTCAAACACGGTTACGGAATCTGGAGAGGATTATACAACGATTCATACATTGGAGAA
TGGAGACATTCCAAAGCTTAGGGCTATGGAGTGCATACTTGGAAAAATGGGGACAGATAT
GAAGGAGAATGGAAGCAATGCTTGAAGCATGGACAAGGAACTGATATTTTTGCTAATGGT
GACATTTACACGGGTGAATACAAAGATGGTAAGCCAGATGGAAAAGGTTAATACACTTGG
AAAAACGAATCTTTTTATATTGGTGATTTCAAGAACGGCTTAAAACATGGGAAAGGTCGC
TGGAAAAGTGGGAAGGGTCCTCAGTGTAATCAATATGAGGGAGACTACTGCCAAGATAAA
AAGCATGGTTATGGTGTTTTCACTTGGGCTAGTGGTAATATCTACAAAGGTGAGTATAAA
GAAGATGAACGAGATGGTTATGGCGAGATGAAGTGGACAGATCAGAGTATATATTAAGGA
GAGTGGCAGAAAGGTATCTAGCATGGTTATGGCAAAATGATATTCCCAAATAACACAGTT
AAAGAGGGCTACTTCGAGTTCAATGTTTATAAAGGTCCTAAGTAGCTCAACAGTCAATAG
TAAGAAGGAGGAGTTTCCCCTTCTTAAGTTGATGTCATGAGATCCACAAGAGCTAGTAGC
AATTTTTATGGAGGCCCAAATCCCAGCAAAATACAGAATAATCAAGATTTGATAAGCATC
CAATAAAATGTACAACTTCCTGAAATAGTACAAATGCAAGGTTAAACAATTCAAAACATG
TCGCCTTAATTAAACAAGAATTAGGCAATTTTACCAAAGTCTATGCCTAAAATCAGAGGC
TCCGCAAACACTAATGTATCTCCTGGCTCTCTAGGAGGGTATGCAGCTACATCAAATGGT
TTTTCTTAAGCAAGTTAGTAATCTTCCTACTACAGACACCAAAGAGATCAAATTACCAGC
AAAGATTCAGCCAGGGGATCTGCTGGAAACAGTGGACTTAATAGAAATGCATCATAGGAA
AGACAGCATAGGATATCACAATTTAATGATTCAATAAACATAGGAAGACAAATCATTCAT
GCTCCTATAACTCACAATAAAATCATGAATCAAAGCAATACTGGTAATAAAGATACGGCA
ATGAGATAAACAGTAAAGAGCAATAACAGTGGTGGAAGCAGCAACAAAAGCTGGATAAAT
TATCAAAAGCAATAGAACCAGTAGTAATAATACCAAAATGCAGATTTCAGTGAGTACTAA
AATATTGGAGATAATTAATATATAAATCCAAATAATAGGGGAACTGTAATATCAAATCAT
TCTGGAAATAAAAAACGAATAATAGCTGCTGCAGCTGGAAGGAAGAAAAGATGA


>Contig1240.1.g132(protein)
MLSQMTGQANHLEYESIVLETHEFDLDMLRELPNYVQRKYPDAIYMGQFSNGKRNGRGVM
RYKNGRQYEGDWESDLRNGKGFERYPNGNSYFGHFMRGKAHGKGVYSWSNGEVYDGEWDQ
GLKHGYGIWRGLYNDSYIGEWRHSKAQGYGVHTWKNGDRYEGEWKQCLKHGQGTDIFANG
DIYTGEYKDGKPDGKGQYTWKNESFYIGDFKNGLKHGKGRWKSGKGPQCNQYEGDYCQDK
KHGYGVFTWASGNIYKGEYKEDERDGYGEMKWTDQSIYQGEWQKGIQHGYGKMIFPNNTV
KEGYFEFNVYKGPKQLNSQQQEGGVSPSQVDVMRSTRASSNFYGGPNPSKIQNNQDLISI
QQNVQLPEIVQMQGQTIQNMSPQLNKNQAILPKSMPKIRGSANTNVSPGSLGGYAATSNG
FSQASQQSSYYRHQRDQITSKDSARGSAGNSGLNRNASQERQHRISQFNDSINIGRQIIH
APITHNKIMNQSNTGNKDTAMRQTVKSNNSGGSSNKSWINYQKQQNQQQQYQNADFSEYQ
NIGDNQYINPNNRGTVISNHSGNKKRIIAAAAGRKKR