Identifiers and Description

Gene Model Identifier

Contig51.1.g14

Standard Name

MORN1bf

Aliases

Contig51_1_g14

Description

MORN repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000474903.998479955315009e-46hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig51.1.g14(coding)
ATGAACCCTGCCTAACTTAGATAAATGATTCACTAATAAGCTCTAGCAAATTAAAATAAC
CGAAATAATAATAATTCAGGTTAAGACACCTCAGAATATGACGGTCTAGGTAGGTTAAGC
TTCCCAAATGGAGATTTTTATGAGGGGTAGTTTAAGAAGGGAAAAATGGAAGGCAAAGGA
AAACTAATTACTGCACGAGGGGATACTTATGAAGGGAACTTCAAAAATGGATTTAAGCAT
GGTTCAGGAAAAATAATCTACAGAAACGGCATAAGCTTTTATGAAGGTGATTGGTACTAT
AATAAAATTGAGGGCAAGGGAATCCTTTTAGATGATTTTGGAAATAAATATGAGGGAGAA
TTTAAGGACAATATGAAAAATGGGCTTGGAAAGTGTTATTATGTAGCAAATGGCATGAGA
TTTGAAGGCTACTGGAGTAATGGAATACCTGAAAAAGGAGAACTTTTCATGAAGAATGGT
AATCATTATGAGGGTGAATGGAGAGACGATAGATTTTCAGGTGTGGGGACTATTAGATTT
GGAAATGGCGACTTGTATGAAGGTGAATGGAAGGAACATGTTCCTCATAGATACGGAAAA
ATGCTTTATAGAAATGGAAAAGTTTATAATGGAGAATGGTTTATGGGACAGAAACATGGC
TAAGGGGTTATGAGCTATCCAAATGGGGATTAATATGAAGGAGAATGGGTGCAAGATATG
AGATAAGGTTTTGGAATTTAGAAGTATTCAAAGGGGGATGCTTATGAGGGTGAATGGTTC
AATGATCGTATTCATGGTAAGGGATTATTAACTCATGCAGATGGCAGTAGTTACGAAGGG
CTTTGGGATAATGGCACTCAAATTGAAGGTCAGGGTGTATTTCAATATTCAAATGGCAAC
GTTGCTATAAGATCAAACTATAATGTGAATGAAAAACAATCTAGCATTTATCAACACACC
CTAGTTAATCAGCAAGTTAAAGCTTTGGAGTACAGGTAACCTATGCTACAAATTTAACAG
GCACCATAATAATTCTTTAAACCAAGACCTCTTCCCTTGCCTTATGCTGCACTAAATTAA
CTTAAATCTCCTAATCTCAATAACTCTTCAATAAAAGACCCTTTAATAAATTAAAGCTTA
AATAATTCTCAAGGACCTAACTTGAATGACTAAAGTCTCTAGCGCACTTTAAGCCAGCAG
AGAGCAGATGGTGAATATAACAATTTAGCAAACAAAAGTATGTAAAATATGAAAAAATAA
GTGAATACACCTGATAATCCATATAGAGATTCAGTTAATAACCGTAGCAAAAGTGTTATA
CGATCCTCAAATATAATGGCATAAAATGGAAAGAATAGTTTAAACAATTCATATATTGGA
GGTGAAAAAACTTTCAAAGGACTTTCAATGATTCCCACAAGGCCTGATATTGAGTGA


>Contig51.1.g14(protein)
MNPAQLRQMIHQQALANQNNRNNNNSGQDTSEYDGLGRLSFPNGDFYEGQFKKGKMEGKG
KLITARGDTYEGNFKNGFKHGSGKIIYRNGISFYEGDWYYNKIEGKGILLDDFGNKYEGE
FKDNMKNGLGKCYYVANGMRFEGYWSNGIPEKGELFMKNGNHYEGEWRDDRFSGVGTIRF
GNGDLYEGEWKEHVPHRYGKMLYRNGKVYNGEWFMGQKHGQGVMSYPNGDQYEGEWVQDM
RQGFGIQKYSKGDAYEGEWFNDRIHGKGLLTHADGSSYEGLWDNGTQIEGQGVFQYSNGN
VAIRSNYNVNEKQSSIYQHTLVNQQVKALEYRQPMLQIQQAPQQFFKPRPLPLPYAALNQ
LKSPNLNNSSIKDPLINQSLNNSQGPNLNDQSLQRTLSQQRADGEYNNLANKSMQNMKKQ
VNTPDNPYRDSVNNRSKSVIRSSNIMAQNGKNSLNNSYIGGEKTFKGLSMIPTRPDIE