Identifiers and Description

Gene Model Identifier

Contig2854.0.g72

Standard Name

MORN1ba

Aliases

Contig2854_0_g72

Description

MORN repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam02493 ) MORN repeat
  • ( pfam12951 ) Autotransporter-associated beta strand repeat
  • ( pfam06739 ) Beta-propeller repeat
  • ( pfam13385 ) Concanavalin A-like lectin/glucanases superfamily

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001960801.999683289470905e-41hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2854.0.g72(coding)
ATGAAACTGAATTCAGATGAGAGAGATTTAAGACATATGACAACTCTTTAAGATGGGGGA
GTGTACCTTGGAGAATGGAGTATTATAACAAATCAAATGGAAGGTTACGGTATTCTTATT
GATCCAAGTTCGTCTGTTTATTTTGGTTTTTGGTAAGATGGATAGAAAAATGGCAAAGGA
GTACTCATCTTCTCAAATGGAAATGTGTATGATGGAGAGTGGTCAAAGAATCTAGCAAAT
GGCTAAGGGACGCTTAGTTATTATTTAGGTGGGAAATATGTCGGGTAATGGCTTGATGAT
GTAGAAAATGGAGAGGGAGTACACATTTTTGCTGATGGAAGCAAATTCATTCCCAAAAAA
AAGAATGAGAAAATGAATGGGCACTAGGAATTTGAAAAGCCTATTGATGATTCTTATATT
GGAGAATATAAAGATAATTTAAAGCATGGCTATGGAGTCTTAGAATCAAGTGACTATAGA
TATGAAGGAAATTGGTTTGAGAATGTAAAGGAGGGAAAGGGAGTTACTACTTGGAAAGAC
GGCAGGAAGTATGATGGCTTCTACGTTAACAATTAATTCAATGGATATGGAGTGTTTACC
GACACTGATGAAAGCGTTTTCGATGGAAAATGGAAAATCGGGAAAAAAAGTGGTCTTGGA
AAATTAACCTTAAAATCTGGAGAAGAAGAATATTAAATGTGGGAAAAAGGAAGTTTAATC
AGGAAAATGTCTAAATAAGAGTATGATAAACTAAACCCTTTTAATAGTGAATAATGA


>Contig2854.0.g72(protein)
MKLNSDERDLRHMTTLQDGGVYLGEWSIITNQMEGYGILIDPSSSVYFGFWQDGQKNGKG
VLIFSNGNVYDGEWSKNLANGQGTLSYYLGGKYVGQWLDDVENGEGVHIFADGSKFIPKK
KNEKMNGHQEFEKPIDDSYIGEYKDNLKHGYGVLESSDYRYEGNWFENVKEGKGVTTWKD
GRKYDGFYVNNQFNGYGVFTDTDESVFDGKWKIGKKSGLGKLTLKSGEEEYQMWEKGSLI
RKMSKQEYDKLNPFNSEQ