Identifiers and Description

Gene Model Identifier

Contig20651.0.g47

Standard Name

MORN1ax

Aliases

Contig20651_0_g47

Description

MORN repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005354301.0004460510701209e-64hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20651.0.g47(coding)
ATGGGAAATTGTAATAGTAGTGTGTGTTATTGCTGCGGCAATAAAGAAAGTCATAATCAT
AACAAAGAGGAAGAAGAAAATTTATAGAAACCTATATCAGAGAGAAATGGCGGAATAGAT
TTGCTAAATTCACCGATGTATGAAGTCGAAAGAGTTGCAAAAAATCATGAGATAATTTTA
GTACCAGATAACTTTAGAATGCATGATACTGCGCATGAAACTCTGACTAAGGATAGTATA
CCAATAAGAGATAAGAAAAATTTGTTTTTACAAGATAGAAGCTTAGAGTTTAAGAAATTT
GAGATAGAGGGAGGCCTAATTTATGAAGGTTAATCAAGGAAAAAAACTGGTGAGCGTCAT
GGTTATGGACGTTTAAGTTGGCCAGATGGCTCATACTTCGAGGGATACTGGGTCGATGGA
AAAGCAGACGGAAGGGGCATCTTCAGTACATCGGATGGAGAAATTTTAGAAGGGGAATGG
AAGAAAGATAAAGCCACTGGCTTGGGAGTGTTCAAGCAAAAGGATGGTTCTAGTATGTTT
AAGGGGTATTTAAGAGACGATGCTTAAAATGGTAGAGGTATTGAACTATGGAGTGACGGG
TCTTACTACAATGGAGAGTACAAGAATGGTTAAAAGCATGGCAGAGGAGTATATTATTGG
GCAGATGGTTCAAAATATATGGGTAATTGGGAACAAGACGAAATGCATGGAGAAGGAGAA
TTCGTTTGGGCTGATGGAAGAAAGTATAAAGGTTCCTTTGCTATGGGAATGATGGAAGGA
GAAGGATCTTACGAATGGAAGGACGGTAGGATGTATCAAGGGGAATATTAAAAGAATAAG
AAGCATGGCTTTGGAATATACATTTATTCTGATTGCAGTCGATTTGAGGGGTAATGGAAA
AATGGGCAGCAAGATGGAGTCGGCTTTCTAATTGATAAATCTGGTTAAAATAGGAGGAAA
GGCGAGTGGTCGAAAGGAACTCACGTTAGATGGCTTGATTGA


>Contig20651.0.g47(protein)
MGNCNSSVCYCCGNKESHNHNKEEEENLQKPISERNGGIDLLNSPMYEVERVAKNHEIIL
VPDNFRMHDTAHETLTKDSIPIRDKKNLFLQDRSLEFKKFEIEGGLIYEGQSRKKTGERH
GYGRLSWPDGSYFEGYWVDGKADGRGIFSTSDGEILEGEWKKDKATGLGVFKQKDGSSMF
KGYLRDDAQNGRGIELWSDGSYYNGEYKNGQKHGRGVYYWADGSKYMGNWEQDEMHGEGE
FVWADGRKYKGSFAMGMMEGEGSYEWKDGRMYQGEYQKNKKHGFGIYIYSDCSRFEGQWK
NGQQDGVGFLIDKSGQNRRKGEWSKGTHVRWLD