Identifiers and Description

Gene Model Identifier

Contig18228.0.g6

Standard Name

MORN1at

Aliases

Contig18228_0_g6

Description

MORN repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000773502.0007889996237956e-71hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18228.0.g6(coding)
ATGGGTTCTGTTTGTTGCTCAACAAGAAACTCACTTGATATAACTTCAACGACTCATTTA
GATGCTTATCGAGGTGGAGGGAGTGCGAAATTTATAAATAGACCAGCCTCAGTGTAGCAA
TCACGCGGCAGTTACAAACCTAAATCCTTTAAAAAGGGCCATAAATCCTATGTTAATTTG
CTAAACTAGAGTCTAGTAGAACAGTAGAACCACTCTCTCCAATAAAAACAAATCAATTAA
AATTCACTAAATAATATCAGTTTAAATAATCTGCTACCTGGCCAGATATCTCCACGATTA
GGCAATAATGGCTTTTCAAGAAATAATCAGTCAATGATGCAATTATAAATGTTTAATCAG
TCTACACTCGACAATTCTGGAGATATGGCTAATTATTTAACAAACTAGAACTAAAACAAT
TTACCCTCAGTGTTAAGGGAATAGCAATATTTTGAAGAATAGATTAGAAAGGAGCATGAG
AAATAAGAATTGTTGAACATGTTTAAGGGCAATTGGAGACTTATGCTAGTTGTGCTTAAA
ATGCAGGCAATTGCCAGAGGGATAGTTACGAGAAATAAAATGTTCAAGAAGCATCATTTT
AGAGCTGTGGCAAGTAAAAACTCTGTTGAATATTTCAGTGTCCTTGTCCATGATATGAGG
AAGAAGCTACCATAATTTAAATACGACTAGGCTAATCTCTAAGAAGATATAGAAAGAGAG
CATAAAAAGCTTTAAGTAGAAAATGAATATATTTATGAAGGTTAGGTTAACTCTAAAACT
GGAATGAGAGATGGAATAGGTACCTAAACATGGGTAGATGGCACTTACTATGAGGGATAC
TGGAAAAATGATTTACAAAATGGAAGGGGTAGAGTATTCAGATCAGATGGAGATGTGTAT
GAGGGTTAATTTATCGATGGGAATGCTAATGGTAAGGGTAAGTTGATAAGCTATTCAGAA
GCAGGGGGAAACGGATCTACTTACACAGGAGAATTCGTAGATAACTATCAGCATGGTAAA
GGGCATGAAGAGTGGCCAGAAGGGGATGTCTATGATGGCATTTACATTAAAGGTGTAAGA
GATGGTCCTGGAGTGTTAAAAATGGCTGATGGTTCAAAGTACACAGGTACTTTCAAGAAG
AATTGCATTCATGGTTTTGGACAGTATCAATGGTCTGATGGAAGAATCTACAATGGTGGG
TGGAATTTCAACAAGATGCACGGAAGAGGCGTCTTCACCTGGAAAGATGGAAGAAAGTAC
GAAGGAGAGTATTACAATGATAAGAAACATGGAAAAGGCTTGTTTATATGGGCAGATGGG
CAGAGATATGACGGGTAATGGGTCAATGGTGTGCAGCATGGCATTGGCTTTCATTAAGAC
AATGCCAGGGCTGATAAGCGAAAGAGTGAATGGAAAAATGGCAAGAGAGTTAGATGGATT
CATGATAATGATAAGAAGAATGACGACAGTGATGAAGATGAATAAAGTGCCAGGAATAAA
AAATATAATAAAAGATGA


>Contig18228.0.g6(protein)
MGSVCCSTRNSLDITSTTHLDAYRGGGSAKFINRPASVQQSRGSYKPKSFKKGHKSYVNL
LNQSLVEQQNHSLQQKQINQNSLNNISLNNLLPGQISPRLGNNGFSRNNQSMMQLQMFNQ
STLDNSGDMANYLTNQNQNNLPSVLREQQYFEEQIRKEHEKQELLNMFKGNWRLMLVVLK
MQAIARGIVTRNKMFKKHHFRAVASKNSVEYFSVLVHDMRKKLPQFKYDQANLQEDIERE
HKKLQVENEYIYEGQVNSKTGMRDGIGTQTWVDGTYYEGYWKNDLQNGRGRVFRSDGDVY
EGQFIDGNANGKGKLISYSEAGGNGSTYTGEFVDNYQHGKGHEEWPEGDVYDGIYIKGVR
DGPGVLKMADGSKYTGTFKKNCIHGFGQYQWSDGRIYNGGWNFNKMHGRGVFTWKDGRKY
EGEYYNDKKHGKGLFIWADGQRYDGQWVNGVQHGIGFHQDNARADKRKSEWKNGKRVRWI
HDNDKKNDDSDEDEQSARNKKYNKR