Identifiers and Description

Gene Model Identifier

Contig19441.0.g40

Standard Name

MORN1as

Aliases

Contig19441_0_g40

Description

MORN repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001960801.0000844672813518e-48hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19441.0.g40(coding)
ATGGAATCCCCCTAACTATAAAACCTCGATAACTGTCTATCTTGCGGTGAAGCTTATGAC
AAGCATTTAAAGCAGAAAGTCATCATTCCATGTGGTGATGTTTATTGCCTAAAATGCATG
TCTTCTGCGTCTTTCTAAGATGACAACTTCAACTGCATCGTATGTGAGCACGATGTAAAA
ATATCCCAAAAGTTCTAAGAAAATTTGTAAAACTTAGTAAGTTACGAACAAAAATTGTAA
ACCACTGGGAAACTTAACCAAGGACTGAATGCGGGATTCTTTTGTCAGGAATGCGAAACA
TACGCTTGTGACTAATGCATTAAAGCAAAGCACAGTGACCACGAGGAATTTCTCTCAATA
TGCAACCATGCTAAAGAGTCGGATTCCAAAAACGTTAAGAGCATTCTTCAAAAATATTCA
ACCCAGGAGAGCAAAATTAAATTTTCAAATTCGGAATCCAAAATAAATAATACCGGACAC
GTCACCCAGCATGACTTATAGAAATAAAATAATGTACCCACAGTTGATGACGAATACGCC
AGATTCTTCTCTCTTATTGAAAATTAAACAGTTCTCGACCAAATGAAACAATATCCTTAA
GTGAAGCTACTGGATTTGAAGAAAAGTTCTGAAAACAGAGAAATCAGATCCATGGTTACT
TTGGAAGACGGCAGTGTATACCTGGGCGAGTGGAACGTTCTAACCAACAAAATGGAAGGT
AAGGGTATGGAAATTCATCAATCTGGCTCTATCTACAGCGGAGAGTTCAAAGACGGGGAA
CTCAATGGCTATGGCATACTCATCTATTCAAATGGAAACATCTACGAAGGCGAATGGGCA
AACGACAAGCGCAACGGTTTGGGTACATTCATAATAAAAGACGGTGGGACCTACGTCGGG
TAATGGAAAGACGGTTTGAAGGAAGGTTAAGGAGTCTATACCTGGCCTAACGGCAACAGG
AAGTTGTCAGAAAATACTCTCAGGGGAGTGATTCATGGAGATCCTAAATCTCCAAGATCA
GTTGGAAGAAAATACTTTGGTGAGTACAAATCCGACAAAAGAAATGGGCACGGTGTCTTG
TAATATGTAAACGGGAACCGCTATGAGGGGGCTTGGTTAGACGACCTCTTCCATGGCTAA
GGAGTCTATACCTGGAGAGACGGCAGTAAATACGAGGGCTGCTGTATTGATGGAATCAGA
GAAGGATACGGAGTTTTAACTTACCCCGATGGGAGCAAGTACGAAGGTAACTGGAAAAAT
CACTGCAAACATGGCATTGCCAAATTCACTTACTTCTCTGGAAAAATTGAGTATGGTGAG
TGGAAGAATGGCAATAAATTTAAGGAGGTTTCTGAAAAAGAGTACCTCTCACTTTTATAA
AATAGAAATTGA


>Contig19441.0.g40(protein)
MESPQLQNLDNCLSCGEAYDKHLKQKVIIPCGDVYCLKCMSSASFQDDNFNCIVCEHDVK
ISQKFQENLQNLVSYEQKLQTTGKLNQGLNAGFFCQECETYACDQCIKAKHSDHEEFLSI
CNHAKESDSKNVKSILQKYSTQESKIKFSNSESKINNTGHVTQHDLQKQNNVPTVDDEYA
RFFSLIENQTVLDQMKQYPQVKLLDLKKSSENREIRSMVTLEDGSVYLGEWNVLTNKMEG
KGMEIHQSGSIYSGEFKDGELNGYGILIYSNGNIYEGEWANDKRNGLGTFIIKDGGTYVG
QWKDGLKEGQGVYTWPNGNRKLSENTLRGVIHGDPKSPRSVGRKYFGEYKSDKRNGHGVL
QYVNGNRYEGAWLDDLFHGQGVYTWRDGSKYEGCCIDGIREGYGVLTYPDGSKYEGNWKN
HCKHGIAKFTYFSGKIEYGEWKNGNKFKEVSEKEYLSLLQNRN