Identifiers and Description

Gene Model Identifier

Contig316.1.g105

Standard Name

MORN1ak

Aliases

Contig316_1_g105

Description

MORN repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005667102.998957050488393e-103hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig316.1.g105(coding)
ATGAAAAATGACATTAGGTCTGCAAATCATATCAACTATAACAACACTAGAATGATGCAT
GGAGAGTCTTATAACGAGATGCACAGTGATAGTGAAGTCATTCTCAATCCAATGATTAAG
GCAATCAGCGATAAATTAGGTCATTTTTAATATACCGATTTGGATTAATGGCGAGGTATT
CCCAGATAGATGCGTTAACCTGTTAAACAAGCTAATGGTGCTGTTTTTATTGGAGAATGG
AATACATAAACAAACAAGAGAGAAGGCAGGGGTAGATAAATATGGCCAGATGGCTCACTC
TATGAAGGTGAGTGGAGGAACGACAAAGCTAACGGGAAAGGAAGATTGATACATTCTGAT
GGAGATGTCTATGAAGGGGATTGGTTCAATGATAAAGCTCAAGGATTTGGAATTTACACA
CATATGGATGGCGCTTAATATCAAGGTTAATGGCAAGAAGATAAACAACATGGAAGAGGG
AAAGAATCGTGGCCAGATGGTGCCACTTATGAAGGAGACTATGTACTTGGGAAGAAACAA
GGTTATGGAGAATTTGTATGGGCAGATGGCTCAGTTTACACTGGGCATTTTTATAACAAC
AATATCGAAGGGGAAGGCGAATATAAATGGTCAGACGGTAGGGTGTTTAAGGGCAATTGG
CGCGCCAATAAAATGCATGGCTTTGGCACATTCACATGGCCAGACAATAGGAGATATGAG
GGAGAATATATACATGATAAGAAAGAAGGACTTGGTACTTTCTACTGGCCTGATGGCAGA
AAATACACTGGGCAGTGGTTGAATGGGAAGTAGCACGGTAGAGGGGAATTCATAGCTGTT
AATAATTAATCAAGAGAAGGCGAATGGAACATGGGGAAGAGAATTAGATGGATAGATGAA
GATTTAACTAATAATGGGTCTATTCTTACAAAAATATGA


>Contig316.1.g105(protein)
MKNDIRSANHINYNNTRMMHGESYNEMHSDSEVILNPMIKAISDKLGHFQYTDLDQWRGI
PRQMRQPVKQANGAVFIGEWNTQTNKREGRGRQIWPDGSLYEGEWRNDKANGKGRLIHSD
GDVYEGDWFNDKAQGFGIYTHMDGAQYQGQWQEDKQHGRGKESWPDGATYEGDYVLGKKQ
GYGEFVWADGSVYTGHFYNNNIEGEGEYKWSDGRVFKGNWRANKMHGFGTFTWPDNRRYE
GEYIHDKKEGLGTFYWPDGRKYTGQWLNGKQHGRGEFIAVNNQSREGEWNMGKRIRWIDE
DLTNNGSILTKI