Identifiers and Description

Gene Model Identifier

Contig16718.0.g103

Standard Name

MORN1ai

Aliases

Contig16718_0_g103

Description

MORN repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010936509.995094197784295e-101hypothetical protein
SGDYJR017C0.000000005997038937208364ESS1 SGDID:S000003778, Chr X f
rom 467033-466521, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16718.0.g103(coding)
ATGGGTAAAAACAAAGGTGGCAAGAAACAGTAGCAACCTGACAGTGACGAAGAAGAAAAA
CAACCTGCTCAATAAGTTTCTTCTACATAATAAAAAGAAGACCCAAAAAAGAAGAAAAAA
GCTGGTGGTTGGAAAGCTCAATTAGAAGAAGAGGAGAAACAGAAGAAGGCAGAGCAAGAG
AGACTTTTAGCAATTAAAAACAAGATTAAATTTGTGAGAGCCAGGCATATTCTACATGAA
GATGAAAATATAGTGAAATAAATCCATTCATAAATCAAGAATGAGCATGGTGACAAACCT
CCTAGCGAGGTTTTTGCTAAATTTGCAGAGGAAAAATCTTAATGCCCATCTAGCAGTAAG
GGTGGACTGCTTGGATACTTCGGCAAAGGCCAAATGGATCCTGCATTTGAAGAAGTTGCT
TTCAAGACACCAGTTGGGAACATGAGTGGAACATCATCCTATAATCCAAACGATCCCTTT
GATAAAAATAAGAAACCTAATGATGGTTCCCCGGCGACAAATGGAGGAGCTAAGTCTTCT
ATAGTAGATGGCTCAACTTCATCAATCTAGCCATATTCAGTGATAAATCACAGAAATCAA
TCAAATCTACTAAATCAATAAAAATCTCTGCAGAATTAAATAAATCCCTTAGCGCTGGAA
ATCTAATAGAACAAGCACTTGAACATGGATTTTTAATCCTAACCCTCGTCTATAGCTTAA
ACTATCATTTCAGATGAATATACTATGGAGTCTACACTGTTTGATTATGATAAGCTTCGT
AAAAACCCTGAGGAATCGAATTTCTTTATAAAACGATATAACTAGGGCAGTATCTATAAG
GGTTAATGTGAAAATGGAAAAAGACATGGTCTTGGTGTAATGATATACTATGATAATTAG
AGAGTTTACGAAGGGCAATGGGAGGTTGATAAAAGATCTGGACGAGGGTATGAACGCTAT
AAAAATGGAAATATTTACGAAGGTGAATTTCTGGACAACAAAGCTAATGGGAGAGGTATA
TACAAATGGAAGAAAGGGGAGATTTATGATGGAGAGTGGCTTAATGGTAAGAAGCAGGGG
CATGGAGTATGGCGTGGAATACACGGTGACTGCTATATTGGTGAGTGGAACAATAGTCTA
GCTGAAGGTTATGGAGTTCATGTATGGAAAAATGGGGATAAGTACGAAGGAGAGTGGGTA
AATTGCCTCAAACACGGTCAAGGAACTGATCTATTTGGCAACGGAGATAGCTACCAAGGT
TAGTATAAGTTTGGTAAGCCTGATGGATTTGGTCAGTACAAGTGGAGTAATGGCAGTTTC
TACATAGGAGAATTGTAAAATGGTTTGAAGCACGGCAAAGGTAAATGGAAGAAAAACAAT
CTTCCCAACTGTAATTAGTATGAAGGTGATTATTAAATGGACAAGAAGCATGGGTTTGGT
GTATTCAATTGGGAAAGCGGAAATGTTTTTAAAGGTAGTTACAAGGATGATTTAAGAGAT
GGGTTTGGTGAAATGTTTTGGACTGATGGATCAACTTATAAAGGAGATTGGGTAAAAGGT
GTATAACACGGACATGGCATCCTGACTCTACCAGATGGTTCTATCAAGGATGGTCCATTT
GAGAATAATATTTTCATGGGCAAGACTAAATACCCTCCCTCCTAAAAGAAACAATCCACA
ATTTAAGAAGATATAGATGGAGAAGAAAACCAGCAAACTATAAAACAAGATGCTTCTTAT
GAAGAAAAAGAAAGAGCTCCTCCTGTGAAACTTACTCTACCAATGATAAGCAGCGCTATG
AATCATCACCTTCAAGATGAGTAATTAGACTTTATCAATTCAAAACGCAAGCCAAATCAC
CATCACTACACTAACAGATTGAGCGACAGCCAATCACTTATCTCTAAAAGTGTAATGCAG
CATCCACAGCAATTAGCCCAAGTTAAATACACACCTGTAACTCAACGAGAGGGAAGATCT
ACAGATAAAAAGACTCGCTACTACTCATATGTGAATCAAAGCCTGCCCGAGATAAACCTA
AAGTACAATAAAATCAATCAATATAACAGCAATAACAATGGAAACAGGATATCACAGTAA
TAGTATAGTAGGAGCAATAGTAGTAGTAGAGGGAATTAACCCACTTAAGAAGACACTGGC
TTAAATCATTAACATAATAATGCTCATAGAAAAGTTAACTAACTAGCGCTTAATCTGTTA
ATAAGAAAAAGTAAACAGAAAAAGAAAGCTATTTGGCTGCCGAATGGATATAAATAGCAA
AGTAAACAATTTCACACAAATGTCAATGGTTCAAATAATTATGGAAGCAAACTTCACAAC
ATCAGTGTGCTTTCAAGTAGAACTGATCTATACATTTGA


>Contig16718.0.g103(protein)
MGKNKGGKKQQQPDSDEEEKQPAQQVSSTQQKEDPKKKKKAGGWKAQLEEEEKQKKAEQE
RLLAIKNKIKFVRARHILHEDENIVKQIHSQIKNEHGDKPPSEVFAKFAEEKSQCPSSSK
GGLLGYFGKGQMDPAFEEVAFKTPVGNMSGTSSYNPNDPFDKNKKPNDGSPATNGGAKSS
IVDGSTSSIQPYSVINHRNQSNLLNQQKSLQNQINPLALEIQQNKHLNMDFQSQPSSIAQ
TIISDEYTMESTLFDYDKLRKNPEESNFFIKRYNQGSIYKGQCENGKRHGLGVMIYYDNQ
RVYEGQWEVDKRSGRGYERYKNGNIYEGEFLDNKANGRGIYKWKKGEIYDGEWLNGKKQG
HGVWRGIHGDCYIGEWNNSLAEGYGVHVWKNGDKYEGEWVNCLKHGQGTDLFGNGDSYQG
QYKFGKPDGFGQYKWSNGSFYIGELQNGLKHGKGKWKKNNLPNCNQYEGDYQMDKKHGFG
VFNWESGNVFKGSYKDDLRDGFGEMFWTDGSTYKGDWVKGVQHGHGILTLPDGSIKDGPF
ENNIFMGKTKYPPSQKKQSTIQEDIDGEENQQTIKQDASYEEKERAPPVKLTLPMISSAM
NHHLQDEQLDFINSKRKPNHHHYTNRLSDSQSLISKSVMQHPQQLAQVKYTPVTQREGRS
TDKKTRYYSYVNQSLPEINLKYNKINQYNSNNNGNRISQQQYSRSNSSSRGNQPTQEDTG
LNHQHNNAHRKVNQLALNLLIRKSKQKKKAIWLPNGYKQQSKQFHTNVNGSNNYGSKLHN
ISVLSSRTDLYI