Identifiers and Description

Gene Model Identifier

Contig13522.0.g75

Standard Name

MORN1ah

Aliases

Contig13522_0_g75

Description

MORN repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000773501.999385218781115e-51hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13522.0.g75(coding)
ATGGGCAACTCACTCTGTTGTAAATCAAATAGTATAGATCTTCAATAAGCCAATCCCAAG
GATCTCACATTAAAATCTGATATGGATAAAGCTAAAAAGGTTGGTTTAATTGAGCGTGGT
CCTTAAGAACTTGAAAATGGAGTTGTATATACTGGGCAGTGGAAAGATGGCAAATAATCC
GGCTTTGGTGTAGAAACATAGCCAGATGGAACCATTTATGAGGGCGACTTTGAAAATGGC
AAGAAACATGGAAAGGGTACATTAAAATTGCCCGATGGATCAGTTTACGTTGGCGAATTT
CAAAATGACTGCAAGCATGGAAAAGGAGTCCTTACTTATCCTGATAACCGTAAATATGAT
GGAGAATGGCAAAATGACTTAATGCATGGTTTTGGTACGTTTTCTTGGGATGACGGTCGT
GAATACATTGGGCAATACGTAGACGACAAAAAGCAAGGATAAGGTGAATTTACTTGGCCT
GATGGGAGATCATATAATGGTGGTTGGTTCAATGGCAAACAGCACGGGAAGGGAATTTAC
TCAACCAGATAAGCAGGAGATTAATATGGAGTGTGGGAAGATGGTAAACGACAAAAGTGG
ATAGACTAAAAAGAATTTGAAGAGCAATCTTGA


>Contig13522.0.g75(protein)
MGNSLCCKSNSIDLQQANPKDLTLKSDMDKAKKVGLIERGPQELENGVVYTGQWKDGKQS
GFGVETQPDGTIYEGDFENGKKHGKGTLKLPDGSVYVGEFQNDCKHGKGVLTYPDNRKYD
GEWQNDLMHGFGTFSWDDGREYIGQYVDDKKQGQGEFTWPDGRSYNGGWFNGKQHGKGIY
STRQAGDQYGVWEDGKRQKWIDQKEFEEQS