Identifiers and Description

Gene Model Identifier

Contig1188.1.g67

Standard Name

MORN1ag

Aliases

Contig1188_1_g67

Description

MORN repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008581209.997093137033517e-262IQ calmodulin-binding motif fa
mily protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1188.1.g67(coding)
ATGAAACAGCAGTACAAGAAATTGTTGCTAAAAGATGGAAAAGGAATAAGTCTAGACTTT
AAAATGATAAGCCATTTATTTGATTTTGCAGAGGTTAAAGCTCGTTAGAGTTTTGGAGTA
AAATAATTTCAAAATGCTTTGTACTAAGGTTCTCTTGATTCTTAAGGCTTAAGAGAGGGA
TTTGGTGTAATGATATATGACACAGGTAGACTTTATGAAGGCTAATGGGTGTAGGATTAA
AGATCAGGCGAAGGATTTGAGTTATACAGTAATGGCAATGAATATAAAGGGGAATTCAAG
CAAAATAAGCCTGAAGGAAAAGGTAGCTACTTATGGGTTAATGGTGATTATTACGAGGGG
TATTGGATTAATGGCGAAAGACATGGCAATGGATGCTGGTACAATCACAAAGAAGAGATA
TATGATGGAGATTGGGACAGAGGAGAAGCAACTGGATATGGAATTATGACATGGAAAAAT
GGTGACAGATATGAAGGCTAGTGGAAAAATTGCAAAAAGCATGGAGAGGGTAAAGATCTA
TTTATAGATGGAAGTAGCTATGTGGGCATGTATGAAGACGGAATTCCTTCAGGAAGAGGT
GAATACTAATGGGTGGATGGAAGTTATTATAAAGGATATTATGAAAAAGGCTTAAAACAT
GGGAAAGGTATCCTATTCAAGAAATCAATTCAAGATACTAATAAATGGATACTTTATGAG
GGTTCTTTCGAAAGAGACAAGAGAAAAGGTTTTGGAGAAGTTAAATGGTCAAACGGCAGC
GAATATAAAGGATACTTTGATTAAGACGAGAGAAGTGGAAAAGGAGAAATGCGATGGTAT
GATGGCACCTTATATATTGGCGAATGGGTTTTGGGAAAACAGCATGGCTGGGGTAGTTTA
AAATTACCAAATAATGAAATTAAAACTGGATACTTTGTTAACAACACATTCCAAGGTACT
GATATGCAATTTGGGTTAAAACAACAGAGTATTCTCTCAAATGGAGGTTTGACATAAAGA
GAGCAATTAAAGAATAATCTGCCTTAAATTGCTTTAAAGTTTGGACTTTAAAGAAGGTCC
CATTCAGAGCTTAAGTTTGATAAAGTGAATCAGAGAGGATCATAGACACAAAGAATTAAA
CATTAAAAATAAATAGTACCATTATGGAAGCCTATTGCACTATTTGACCCGGTAAGAGTG
AGCCCAGAGGAAGTTGGAAAAATTATTCATGCTCTACAGGAAGAAATCAAGATCATAAAG
CTATAATTAGAAAATCTACCTGGCTACAGTAAAGGTGAGGTACCCCCACATTTGCATAAG
TTAAAATCTGAACTTGAAAAAATCTATGAGAGCTTGGAGAAGAAAAATGAAATATTGATG
AATTAAATGATGAAGAATTTCGGAAAGACATAGCAAGATCTTCCTAATTTCAAGTTGCCT
GATATTCCACCTTAATCAGTTAAAAGACCTTCATTATATGAAATGCAAAGTCCACCAGAA
GATATAAACGGATCTTAATTTGGTTCGTTTTAAGCCAAAGGGACTGGAATACTCAAACCA
CAAGCAGGACGATGGTCAGGGAGATAGACATATACTGCCAAAAATTCCTTAGGAGGCATC
TTCAAAAGTAAAAAGTGGAAAATGCAAGGAACTTTGGATGGTGGTTCTACTGATCCTCCC
CCAATTAATGAAGAAGACATTAACAAAGGCATGATCAATCTTTTGAACAAAGGCATTATA
CCAAGAGATGTTGATTTAACTCCTGCTTTTGAAAAAGGTGCTCCACCAGTTATGTGCAAA
GGAGTGAGGTTCTATGAGAAACGGGAATAAAACGTGAAGAGAGAGATTCAAACTGGTCCT
ACTTTCCAAAACTAATTAAAATTTGATTTGTAACCCCTCCCTTAAATAGCAAAGACTAGA
CAACTTGTGCCTCTATATTAAGGTGATTAGACTTATATAAATCGATAAATGTAACCATCG
ATTGCAAATATTTAATTTGGACAGAATAACAACTTCTTAGCTCTTCCTGCCCCTGGTGAT
GAGTACAAATCATTTAGTTAAAGCTAAACTATATAACAATAAAACTATCAAAATAACTTC
TCGCAATCATAAATTGATTTGTAAAAGGACAGATCCTATAACGAACTCATGGATATTTAT
TCTTTGCATGAGTTCATTATCCGCAAAGGCAAGGTTTTAGATTAAACTCCTGAGTTTATT
TCATTTAAGCGTACGTATATTCACAAATGGGGCTCAATTTCTTACATAATTCACTTACTT
GAAAAGTTATTGACAACATATAACATTGATATGGCTTATGTTGAAGGTAAATAAGTAGCA
ATGCTTGCTGAAGAAGATCTTAAAAAGCCTTCAAATGATCTTTTATTTGATTGCATTGTA
AACAAAGAAGAAGTTGGTAAAATCATAAAAATCCCTTCTCGTATGTTCAAAGGGCCTAAG
GGACCAGAGATTGCTGCAATAACTATATAGAAGAACTGGCGAATGTATAAAGCACATACA
GCCTATAACTAACTCAAATTCTTAATGGGGAAGGCAGCTATTATTTAAAAAAGATTCCGA
CTGTTCTAATTTTAAAAACAAACTAAGGCTAAAGTAGAGGAACTGACAAATGAGAGCTTA
TTTGTATGGAGAGAAATGATGGAAGAGTTCAAAATATAAGAGATGAAAAGAATATCTATG
GAAAAGTTCTTATAGAGAGAAAATGCTCAAATTAGTAGAATATTTGCTGTTAAAGATCCG
TTAGTTGAAGTTATCTACATCTCGCCATTTTAAATGACGAATGATGTAGTAGGATATTAC
ATGAAAATTCTTGAAATTGGAGAAATAGAAGGAGCTAATAGCAAACTAAATATAATCGTC
CCAGATAACATTCAAAAGTTCCCCCATCATTTCTCCCTATCCTAAGTTTTGATGTACAGT
CCAAAGACAGTGAAAAGAATCAAAAGTCTAATTAAAGGCAAATAAGCATATATTGTTCCT
GGCATAACTTCAACAGATGACATTAAACTTTCAATTCAACTTTAGGTACCTATACTTTCA
GGTGAGCCTTCAAAACAGAACCTTTATTCAACAAAATCAGGATCAAAGAAGATATTCTAA
CTTGCCGATGTACCGACCCCAATAAGCGCAATAGATATTTACGATGAACAGGAATTCTAC
TTGTCTTTGGCTAAACTTATAGCAAATAATATGTATGTTCAAACTTGGATATTCAAGATT
GATGATGAGTTTAATGGAAGAGGACATGCTTATTTAACTATAGATAATATAAAGGCTTTA
GCTGATATGAGGAGAAAATAGCTTGAAATTAATGAAGAATTAGTTGACAAAATTATTAGT
ATCTTGACTAAAATCTTGCCTAAAAAAGTTAAGATCGCGATGTAAAGACTTTATGATGGC
TGGCAAGATTTTCTGTAAGCATTTTGTAAAGTAGGAGGAGTGATAGAAGCTGCACCAACT
TGCATGTCTAATTAGTTAGGTTCTCCAAGTATCTCGTTCTTGATTGAGCCAAACGGAGAA
GTTTTACTGATTGGGTCAATGGACAGATTTTCTGCAAGAGAATACATTAATTCAGGATGC
TTTTTCCCTCAATAATCATTGCCAAATATGAATATGATGACTATCTCAAAATCAATAGGA
GACATACTCTATGAGAAAGGCATTATTGGACACATTACTGTAGACCTTGTTTCTTTTCCT
GATCCCACCTCACCATAAAGTCATCCTTTATTTTGGGCTGTTGATCTAAACTGCGGAATG
ACTGACTATTCATCAGCTTGCTTTTTCTTTGATTTTTTAATGGATGGTTAATTGGACTAA
TTTACTGGCAAATACTACATAGAAAATGCTTAAGACAGCATAACATCCTCAGCAAATGGT
TCACGAATGGGTTCAAAATATTTAAAGAGAAATAATTCAAATTACAAATCGAATAAGGAC
CCAGTGTCTTCAAGAAGTTTCATGTACTGCAAATATCTTCATCACCCAGGTCTTGCCTCA
ATCCAGTACAAAACCTTCTTCCACATGTGCAGATTAGAATCGATATCATTTGATCTTGAG
AGGAGATCTGGAGCTACATTCATGCTACAGGATTGCCTATAAAGTGGAGTAATTGCAATG
ATGACCATAGCAGAAGAAAGAAAAGAATGCTTATAATAAATGGTGGATGCATTCAAGTTT
ATTGAGAATCAAGCTGGAAATGCAGGTATCATGTCGAAATAGAAAAATATAATGGATGAA
AGCAGAACTGATGAAGTGGACATAGCTGATGTAATTAGTGCAGTTAGACTAATATACAAG
GCTTTCGTTAAGAAAGAGGAAAAAGAGAAAATATAAAGAGCTAACTAGAGGAAAAAGTGA


>Contig1188.1.g67(protein)
MKQQYKKLLLKDGKGISLDFKMISHLFDFAEVKARQSFGVKQFQNALYQGSLDSQGLREG
FGVMIYDTGRLYEGQWVQDQRSGEGFELYSNGNEYKGEFKQNKPEGKGSYLWVNGDYYEG
YWINGERHGNGCWYNHKEEIYDGDWDRGEATGYGIMTWKNGDRYEGQWKNCKKHGEGKDL
FIDGSSYVGMYEDGIPSGRGEYQWVDGSYYKGYYEKGLKHGKGILFKKSIQDTNKWILYE
GSFERDKRKGFGEVKWSNGSEYKGYFDQDERSGKGEMRWYDGTLYIGEWVLGKQHGWGSL
KLPNNEIKTGYFVNNTFQGTDMQFGLKQQSILSNGGLTQREQLKNNLPQIALKFGLQRRS
HSELKFDKVNQRGSQTQRIKHQKQIVPLWKPIALFDPVRVSPEEVGKIIHALQEEIKIIK
LQLENLPGYSKGEVPPHLHKLKSELEKIYESLEKKNEILMNQMMKNFGKTQQDLPNFKLP
DIPPQSVKRPSLYEMQSPPEDINGSQFGSFQAKGTGILKPQAGRWSGRQTYTAKNSLGGI
FKSKKWKMQGTLDGGSTDPPPINEEDINKGMINLLNKGIIPRDVDLTPAFEKGAPPVMCK
GVRFYEKREQNVKREIQTGPTFQNQLKFDLQPLPQIAKTRQLVPLYQGDQTYINRQMQPS
IANIQFGQNNNFLALPAPGDEYKSFSQSQTIQQQNYQNNFSQSQIDLQKDRSYNELMDIY
SLHEFIIRKGKVLDQTPEFISFKRTYIHKWGSISYIIHLLEKLLTTYNIDMAYVEGKQVA
MLAEEDLKKPSNDLLFDCIVNKEEVGKIIKIPSRMFKGPKGPEIAAITIQKNWRMYKAHT
AYNQLKFLMGKAAIIQKRFRLFQFQKQTKAKVEELTNESLFVWREMMEEFKIQEMKRISM
EKFLQRENAQISRIFAVKDPLVEVIYISPFQMTNDVVGYYMKILEIGEIEGANSKLNIIV
PDNIQKFPHHFSLSQVLMYSPKTVKRIKSLIKGKQAYIVPGITSTDDIKLSIQLQVPILS
GEPSKQNLYSTKSGSKKIFQLADVPTPISAIDIYDEQEFYLSLAKLIANNMYVQTWIFKI
DDEFNGRGHAYLTIDNIKALADMRRKQLEINEELVDKIISILTKILPKKVKIAMQRLYDG
WQDFLQAFCKVGGVIEAAPTCMSNQLGSPSISFLIEPNGEVLLIGSMDRFSAREYINSGC
FFPQQSLPNMNMMTISKSIGDILYEKGIIGHITVDLVSFPDPTSPQSHPLFWAVDLNCGM
TDYSSACFFFDFLMDGQLDQFTGKYYIENAQDSITSSANGSRMGSKYLKRNNSNYKSNKD
PVSSRSFMYCKYLHHPGLASIQYKTFFHMCRLESISFDLERRSGATFMLQDCLQSGVIAM
MTIAEERKECLQQMVDAFKFIENQAGNAGIMSKQKNIMDESRTDEVDIADVISAVRLIYK
AFVKKEEKEKIQRANQRKK