Identifiers and Description

Gene Model Identifier

Contig428.1.g120

Standard Name

MORN1ac

Aliases

Contig428_1_g120

Description

IQ calmodulin-binding motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003270309.997093137033517e-262IQ calmodulin-binding motif fa
mily protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig428.1.g120(coding)
ATGGCTTAAACTTATTCAGAGAGCAAGAAATAATAAACAATGATCGGTACAATATCTAAG
CCAATTAGATCTTTAGTAAAGGAAAACAAATTGAATCAAATACTTGGAGATCCTGAAAAC
TAAGCAGGTCACAACTATCTTAGAAATAAGTACGCTCTCCCTAAGCCTAATGTAGTAAAA
TATGGAAGATCATAAGGAGCAATTAGTAATAATGATTTAGAAAAATTAGGAGCTAATACC
CTTAGATCAAAGAAAGTAGCCTTGCCAAAAAGAATTTTACCTAAACAGTACAGAGATGAT
CCTTTTGCAGATCCACCTCCTATAACAGAAGATGACATTGCAGATGGAATGTTCAGTTTG
TTGAATCGAGGTATTATACCAAGAGATGTCGATCTTTCACCGGCTTTTGAAAGAGGTAAC
GCTCCTTTTATGTTCTAAAAGGCTCATCTCTTTGACAAACCCAAAAATGTCCCAATGAAT
TAAAAGCAGGTATCTGCCCCTCCTGTAGCCATAAAATATTAAAAAACTGGTGATGACTAA
AACTTGTAAAACACCAATACATTTTTGACATCTCTTGGAAACAACCAAATCTTATCAAGT
TAAATTCAACAGCAAAAAACTAATAACGGCTTGCAAAAACCAGGGAATTTTGAACCTCCA
CAAAACAATAACATAAATGATCAAGATCCCGATAACTATCAGTTAGCTCTAAGATAAGAA
GATTAAATAGCAGAGAGAAAAAGGATAGATTTGGATGAGTATTAACTGTCAGCAGGAATG
GATATGGATGATGAACATTTATCAGCACTTGGCACTGGGTAATTCAATGCAATTAAATCC
CTACTTGACCAAGTTAATTTTGTAATTAAAAAAGGCAAAGTTCTTGATCAATCACAGGAA
TACTTGCAGTTCAAAAGAGCAAACATTACAAAATGGGGATCTATTTAGTTTGTTGTTTAA
TAATTAGAGAGATTTCTGGGACAGTATAATGTACCTTTTGCTAATATAGACACAAAGAAG
GTCCTATATTTTTCAGAGCAAGAATTTGAAAACTTATCAGATGATGACTTACTCAGTTGT
ATAAGTAATAGATAGCAAGTTTGGGAGGCGATTAAAAATCCAAAATAAAAATTCAAAGGA
CCTTATGGTCCAGTTTTAGCTGCAATTAATATTCAAAAGAATTGGAGAAGATACAAGGCT
TACAGTGCTTATTCTCAATTAAAGTTCTTAATGGAAAAAGCTACAATTATTCAGAGAAAG
TTTAGATTATACCAACTTAAGAAATCCACAAAGAATAAGATTAAAGAACTGAACAAAGAG
TCAATGACTGTCTGGAGAGAAATGTAAGATGAATTTAAAAAGAGGTGGGGAGAAATAAAA
AAGCAAAAAAGAGTTGAAATACACATTAACTCCTACTCTATATCTGAAATGTAAAGAATG
ACTATTGAAAAACTTAAACAAAAAGAAAATGCTTAAATTGCTAGAATATTTTCAGTTAAA
GATCCTAATGTTGATGTTATATACGTTAGTCCCTTTACCTTGACAAATGATGTCTATAAG
TATTACTTGAAAATATTGGAACTAGTTGAAATAGAAAACCCTGAAAAAAGATTCAATGTG
ATTGTCCCAGAGAATTATGTCAAGTTCCCTTAACATTTCAGTGTTAGTCAAGCTTTACTA
TACTCTCCAAAGGCATTAAAAAGAATACAAAGTCTAATTAAAGGAAAGTAAGCTTATGTC
GTCCCTGGTATGGTAAACGATTATGACGTAAAACTCTCGATTCAACTTGCAGTTCCTATC
CTCTGTGGTGAGCCAGAAAAGACAAATCTGTATTCAACAAAATCTGGAGCTAAGCGCATA
TTCTAATAAGCTGATGTGCCTACTCCCATATCTGCTTATGATATCTATGATAGAAATGAA
TTTGATCTTTCTCTCGCTAGATTAATCTCACATAATCTATACGTTAATACTTGGCTCTTT
AAAATTGATGACGAGGTGAATGGCAGAGGACATGCTTCTCTGAATGTAGAAACTATAAAA
ACAATTATAGAGCTTAGAAAGAAGAAAGTTGAAATGACTGAATCTATTATTGAAAAGTTG
CTTGAAGTACTAAGGAAGGTATTGCCAAAGAAAGTCAAAATTGCCTAACCAACACTATTT
AAGAACTGGGAAGAATACATTGATCATTTCTGTAGAATTGGTGGAGTTATTGAAGCTGCT
CCAATGTGTCCTCCTAATGCTTTGGCTTCTCCATCAATATCCTTTTTCCTAGAGCCAGAT
GGAAATGTTGAACTGATTGGGTCATTTGATAAGTTTGCAGCTAAGGAATACAATAATGCA
GGGTGTGAAGTTTTATATGAGAAAGGAGTCATAGGTCATGTTACAATCGACTTGGTAAGT
TTCCCAGACCCAACAAACCCGAAAGCCCATCCTTTATTCTGGGCAGTGGACATAAACTGC
TCTCTTTCTGACTATGCAACAATTTGTCTCTTCTTTGATATACTGATGGAAGGTAGACTA
GATCCACAAACAGGGGAGTATTCCATTGAAGTGATAAAGGATCCAGATGATATTGGAGAT
AGAGAATTCGATGAGAAGAAGCCAAATAACTTCTTTGAGTAAAGGAACTTCATGTTCTGT
AGATTCCTTCATCATCCAGGACTTGCTACTATTTAGTATAAAACTTTCTTCCATATGTGT
CGTTTGGAATCTATTTCATTTGATATGGAGAAACGTAGTGGAAGTACATTCGTACTTTAT
GACTGTCTTCAGAGTGGAGTAATAGCTATGCTTACTATAGGTGTTCATAGAAAAGTATCT
GTTAATCACATGGTTGATGCATTAAACTTCATTTAAAATCAGGCTGGTGTTATTCCACAG
AGAGCATTAATGGATGATGTTAGAACTGACGAAGTTGCAATAGGAGATGTGATTTAAAGA
GTTAGGTTAATTAACAGAGCATTCGAAAAGAAGACCAAGAAAAACATAAAAGGAGAGAAA
ATATCATTTATGTCAGAAATTATCTGA


>Contig428.1.g120(protein)
MAQTYSESKKQQTMIGTISKPIRSLVKENKLNQILGDPENQAGHNYLRNKYALPKPNVVK
YGRSQGAISNNDLEKLGANTLRSKKVALPKRILPKQYRDDPFADPPPITEDDIADGMFSL
LNRGIIPRDVDLSPAFERGNAPFMFQKAHLFDKPKNVPMNQKQVSAPPVAIKYQKTGDDQ
NLQNTNTFLTSLGNNQILSSQIQQQKTNNGLQKPGNFEPPQNNNINDQDPDNYQLALRQE
DQIAERKRIDLDEYQLSAGMDMDDEHLSALGTGQFNAIKSLLDQVNFVIKKGKVLDQSQE
YLQFKRANITKWGSIQFVVQQLERFLGQYNVPFANIDTKKVLYFSEQEFENLSDDDLLSC
ISNRQQVWEAIKNPKQKFKGPYGPVLAAINIQKNWRRYKAYSAYSQLKFLMEKATIIQRK
FRLYQLKKSTKNKIKELNKESMTVWREMQDEFKKRWGEIKKQKRVEIHINSYSISEMQRM
TIEKLKQKENAQIARIFSVKDPNVDVIYVSPFTLTNDVYKYYLKILELVEIENPEKRFNV
IVPENYVKFPQHFSVSQALLYSPKALKRIQSLIKGKQAYVVPGMVNDYDVKLSIQLAVPI
LCGEPEKTNLYSTKSGAKRIFQQADVPTPISAYDIYDRNEFDLSLARLISHNLYVNTWLF
KIDDEVNGRGHASLNVETIKTIIELRKKKVEMTESIIEKLLEVLRKVLPKKVKIAQPTLF
KNWEEYIDHFCRIGGVIEAAPMCPPNALASPSISFFLEPDGNVELIGSFDKFAAKEYNNA
GCEVLYEKGVIGHVTIDLVSFPDPTNPKAHPLFWAVDINCSLSDYATICLFFDILMEGRL
DPQTGEYSIEVIKDPDDIGDREFDEKKPNNFFEQRNFMFCRFLHHPGLATIQYKTFFHMC
RLESISFDMEKRSGSTFVLYDCLQSGVIAMLTIGVHRKVSVNHMVDALNFIQNQAGVIPQ
RALMDDVRTDEVAIGDVIQRVRLINRAFEKKTKKNIKGEKISFMSEII