Identifiers and Description

Gene Model Identifier

Contig2749.0.g53

Standard Name

MORN1ab

Aliases

Contig2749_0_g53

Description

MORN repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001960808.99834771533842e-118hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2749.0.g53(coding)
ATGGGAAACACTTGCAATACTTGCAACTGCGATGGCAAAGGAGAAGCAACTCCAAATGAA
TTCACAATTCAGGATCAAGCCTAATATATGAAAAACTACAATTAGTAAAATCATGGGAAC
ATCTCAGGAGGAGAGCATAGAAAAAGTTTTAATGAATTAGGAAATGGTACTACTTCAGGA
AATTCCTCATAGAACTAATAAAGAAGAGGAACTGATAAAAATGGATACTAAAATTCAAAC
AATAACACATCTCAAAATAATAACAATACTTCATTTGGTCAGCGCAAAGACATTACTGAT
GATTACTTAAAGAAAAATATGAAGAAAATCATTAAAATTTAGGCTGCTTTTAGAGGCCAT
AGAGCCAGACGCTTAACTTCACTGTTGAGATCTAAGCATATCGGCTCTAGTAAATATTTC
ACCTATGAAGAATCAAAGGAGACAGTAACCAAGAAAATGTACAATCCAGATTAGCAGAGA
GAGCGCAGACCACCTTATTCATTCAAGACAGGAGCAGTTTACACTGGAGAATGGAAAGGA
GGATTTAGAGATGGTTAGGGAGAGCAAAGATGGCCAGATGGAGCTACTTATGTTGGAGAA
TGGAGAGAAAACAGAGCTCATGGCAGAGGTAAATTTATTCATGTGGATGGTGATATTTAT
GATGGCTTCTGGGCTAATGATAAAGCAAATGGTCATGGCGTTTATAAGCATGTCAATGGA
GCACAGTATGAAGGTTAGTGGAAAGATGATCTTTAACATGGTTTTGGGGTTGAGACATGG
ACTGATGGCTCTAAGTATGAGGGAAGCTATTCTTAAGGTAGGAAAGATGGCATTGGAGCT
TATGAATGGAATGATGGAAGCAAATATACTGGCGATTGGGTTGAAAATAAAATCAGCGGT
ATTGGTATTTATTCATGGCTTGATGGTCGTAGCTACGAAGGAGAGTGGAAGAATAATAAC
ATGGAAGGAATGGGAGTATACATATGGAACGATGGCAGAAAGTATGAAGGACAATATAAA
GATGATAAAAAACACGGATTCGGAGTATACATCTGGGCAGACGGCAGATTATATGAAGGT
TTCTGGTGGAAAGGAAAACAGCATGGTATTGGTACTTATCTAGTACCAAAAGACGGCAAA
GTAAAATATGGTCTTTGGGAAGATGGCAAAAGAACAGAATGGTTCAATGAAAATGATGTC
AATCTCATCAATCAACGCAAACTAGACTACTCTCAGTTCTTCCATCAATCAGATAGTGGT
GAGATGGTTATTCCTGATGCTTCATTCAGAAGACCTAACGGATTTGATGATAAACTTGGT
GACATTAAGCGCAAAATCGCAACACTTAGATCAAAGTAAAAGTTAGCAAGTCAAACTGCA
GGCATGAATTACTGA


>Contig2749.0.g53(protein)
MGNTCNTCNCDGKGEATPNEFTIQDQAQYMKNYNQQNHGNISGGEHRKSFNELGNGTTSG
NSSQNQQRRGTDKNGYQNSNNNTSQNNNNTSFGQRKDITDDYLKKNMKKIIKIQAAFRGH
RARRLTSLLRSKHIGSSKYFTYEESKETVTKKMYNPDQQRERRPPYSFKTGAVYTGEWKG
GFRDGQGEQRWPDGATYVGEWRENRAHGRGKFIHVDGDIYDGFWANDKANGHGVYKHVNG
AQYEGQWKDDLQHGFGVETWTDGSKYEGSYSQGRKDGIGAYEWNDGSKYTGDWVENKISG
IGIYSWLDGRSYEGEWKNNNMEGMGVYIWNDGRKYEGQYKDDKKHGFGVYIWADGRLYEG
FWWKGKQHGIGTYLVPKDGKVKYGLWEDGKRTEWFNENDVNLINQRKLDYSQFFHQSDSG
EMVIPDASFRRPNGFDDKLGDIKRKIATLRSKQKLASQTAGMNY