Identifiers and Description

Gene Model Identifier

Contig15105.0.g32

Standard Name

MND1b

Aliases

Contig15105_0_g32

Description

Mnd1 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam03962 ) Mnd1 family
  • ( pfam05335 ) Protein of unknown function (DUF745)
  • ( pfam03961 ) Protein of unknown function (DUF342)
  • ( pfam13747 ) Domain of unknown function (DUF4164)
  • ( pfam07106 ) Tat binding protein 1(TBP-1)-interacting protein (TBPIP)
  • ( pfam11262 ) Transcription factor/nuclear export subunit protein 2
  • ( pfam10186 ) UV radiation resistance protein and autophagy-related subunit 14
  • ( pfam10351 ) Golgi-body localisation protein domain
  • ( pfam13729 ) F plasmid transfer operon, TraF, protein
  • ( pfam01765 ) Ribosome recycling factor
  • ( pfam04740 ) LXG domain of WXG superfamily
  • ( pfam13675 ) Type IV pili methyl-accepting chemotaxis transducer N-term
  • ( pfam00469 ) Negative factor, (F-Protein) or Nef
  • ( pfam02388 ) FemAB family
  • ( pfam04799 ) fzo-like conserved region
  • ( pfam06156 ) Protein of unknown function (DUF972)
  • ( pfam07795 ) Protein of unknown function (DUF1635)
  • ( pfam09440 ) eIF3 subunit 6 N terminal domain
  • ( pfam12022 ) Domain of unknown function (DUF3510)
  • ( pfam06476 ) Protein of unknown function (DUF1090)
  • ( pfam05003 ) Protein of unknown function (DUF668)
  • ( pfam07926 ) TPR/MLP1/MLP2-like protein
  • ( pfam00804 ) Syntaxin
  • ( pfam04111 ) Autophagy protein Apg6
  • ( pfam04156 ) IncA protein
  • ( pfam13600 ) N-terminal domain of unknown function (DUF4140)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003822905.002276765025871e-34Mnd1 family protein
SGDYGL183C0.000000000003001226732525078MND1 SGDID:S000003151, Chr VII
from 157199-156543,15728...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15105.0.g32(coding)
ATGGGAGGGAAGAAGAAAGGTTTGTCTTTTGAAGATAAGAGATAAAAACTATTGGAAGTC
TATTATGAGAAGAAAGAAGCATTGAACTTGAAAGAAATAGAAAAGTGGGGTCCAAAGAAA
GGAATAGTACTGTAAACCGTGAAGGATGTGAACCAAAGCTTAATAGACGATAATTTGGTA
CAAACTGATAAGATAGGTGCGGGAGCTTTCTTCTGGGCTTTACCTTCACAAGGTCTTAAT
GTGAGGAAACAATTGTTTCAAGAATACGACAATAAAATAGAGAAAGCAAAATAAGATATA
AAAGAGACTAAAGATTTGATAGAGAGAGCACTTTAAGAACGAGATAATAAGGATGGAACA
AGAGATAAGCTATAAGAATAGCTTTCAAAGCTTCAGAAAGAGAAGGCCGAGGTAGACTCA
CAATTGAAAAATTATGAGCGAAGTGATCCTAAAATCATTCAAAAAATGGAGGATGATAGT
GCAATATCCAAGTAGGCGGCGAATAGGTGGACTGATAATTTGTACATAATAATGTAATGG
ATTTAATAGAGTAAGCCAAATTGTACTGAGAAGGATTTAGAGAGTAATTTCCCTATATTC
AGGAATCTTGATTATATAGAGTGA


>Contig15105.0.g32(protein)
MGGKKKGLSFEDKRQKLLEVYYEKKEALNLKEIEKWGPKKGIVLQTVKDVNQSLIDDNLV
QTDKIGAGAFFWALPSQGLNVRKQLFQEYDNKIEKAKQDIKETKDLIERALQERDNKDGT
RDKLQEQLSKLQKEKAEVDSQLKNYERSDPKIIQKMEDDSAISKQAANRWTDNLYIIMQW
IQQSKPNCTEKDLESNFPIFRNLDYIE