Identifiers and Description

Gene Model Identifier

Contig21995.0.g123

Standard Name

MND1a

Aliases

Contig21995_0_g123

Description

Mnd1 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003822901.000382677035467e-28Mnd1 family protein
SGDYGL183C0.0007003012208360162MND1 SGDID:S000003151, Chr VII
from 157199-156543,15728...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21995.0.g123(coding)
ATGAGAAAGTAAATTTTACTTTAGTTAATTTTACTATTCTTTTAGAAAGAGGTTTTCAAT
CTTAAGGAGATTGAGAAGTGGGGTGCTAAAAAGGGTGTTGTTTTGCAGACCATCAAGGAT
GTGAACTAAAGTTTAGTTGACGACAATCTTGTGAACACTGACAAGATCGGAGCTGGTGCT
TTCTTTTGGGCTCTTCCTTCGATGGGTTATTAATCGAGATAAAACTTGATTAATAACGTG
ACTCAAAACACCGCAGAGGTGGAAAAGGACATCTCTGAAGCTGAGGTAAAGATTGAGCAA
GAAAAGGAAGTGAGAGTTCCTATGGATGGCAAGAGAGAACAGATGCTCAAAGAACTGGAG
GAGTTAAAGAAAGAGAACTCAGAGCTCAACACAAGGATCAAGATGTACGAGAAATGTGAC
CCCAAGAGACTTGATGAGATCAATGCAAACAAGAAGATTTGCAAAGATGCTATGGTCAGA
TGGACTGACAATTTGTATGAGATGGAGAACTGGATAAAGAAGAATAATCAGGCAATGACA
AATTAGGAACTTCACTAAGCTTTCCCTATTCTCAAAGATCTTGATTATTTGGACTGA


>Contig21995.0.g123(protein)
MRKQILLQLILLFFQKEVFNLKEIEKWGAKKGVVLQTIKDVNQSLVDDNLVNTDKIGAGA
FFWALPSMGYQSRQNLINNVTQNTAEVEKDISEAEVKIEQEKEVRVPMDGKREQMLKELE
ELKKENSELNTRIKMYEKCDPKRLDEINANKKICKDAMVRWTDNLYEMENWIKKNNQAMT
NQELHQAFPILKDLDYLD