Identifiers and Description

Gene Model Identifier

Contig21148.0.g93

Standard Name

MNAT1b

Aliases

Contig21148_0_g93

Description

CDK-activating kinase assembly factor MAT1

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( pfam06391 ) CDK-activating kinase assembly factor MAT1
  • ( pfam13923 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam07282 ) Putative transposase DNA-binding domain
  • ( pfam13639 ) Ring finger domain
  • ( pfam00097 ) Zinc finger, C3HC4 type (RING finger)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDR460W0.00000000030007160092483236TFB3 SGDID:S000002868, Chr IV
from 1383811-1384776, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21148.0.g93(coding)
ATGTTAGACACTGCAATGTCCTCAGCTTAAAATGGTTCCTCATCATATGATAGTGAACTA
AAATGTCCGAAATGTTTTGCCAGAGCCACTAATGACCTCAATTCTATATTCGCACCACAA
CAACAATCAAACACTGTCAAATTCGTATATTCAACGAAGTGTCCACATTATTTATGCATC
AACTGCAAAAATGAGTTGTACAGATCTGCCACTTCTCAAAACAAGCAACTCAAATGTTTT
TCTTGTCAGATGTTTCTGAAATCTTAAGACTACACCGAGTAGAGCTAGGAGGAGTATCTG
TTTGATAAGGATTTACAAAAACGTCAGGCTATCATGAAAATATACAACAAGAAGAGACAA
GACTTTGCCACTGCACAAGAGTACAACGCATACTTGGAGGATGTCGAGGATAAAATTCAA
AAGTTAATTGATGGGGAAGACGTGGAATTGATTTAAAGGCAAATAAAGGAATATATGAAT
AGAAATCGCCAACAAATTGCGGTTGCTAACCTCAAGAAATAAGAATAGCTACGTGCCCTA
GAACTAATGATAAAAGCAGAAAACCAAAAATTAAATAGTTACGGTTATAATTAGCAGGAT
AGTATGGATTAGTTGACACAAGAGAGAGTGTCAAAATTGCTGCAGGGCTTTAAATTAGAT
GATTTGGATAAACTGGGTGAAACTCAAAATTAAGTGGTTGCTGAATCTGAGTTTCAGGAT
TCGTCACAAGTTTCTTAAACATAAAACTAGCTGCAACAATAGTAATAGAGATTTGTCGAA
CCTTACATTTATGCCTTATATCGCACAGACATGCCACGCTAAATCGAATAAACCCACATC
CCCTCAAACAACACTCTCGCTTAAATCATAGCAAGCTCTGGCCTGATAAGAAAATCTCAA
GTAGAAAATTTGAGTGCAACATTTAAAACTGATGTGCCATAGAATTATAAAATGATGGAT
TTACACAAATAGAAAGCTTCAAAATTGTTCAGAAGTGGCCTGTTTTGA


>Contig21148.0.g93(protein)
MLDTAMSSAQNGSSSYDSELKCPKCFARATNDLNSIFAPQQQSNTVKFVYSTKCPHYLCI
NCKNELYRSATSQNKQLKCFSCQMFLKSQDYTEQSQEEYLFDKDLQKRQAIMKIYNKKRQ
DFATAQEYNAYLEDVEDKIQKLIDGEDVELIQRQIKEYMNRNRQQIAVANLKKQEQLRAL
ELMIKAENQKLNSYGYNQQDSMDQLTQERVSKLLQGFKLDDLDKLGETQNQVVAESEFQD
SSQVSQTQNQLQQQQQRFVEPYIYALYRTDMPRQIEQTHIPSNNTLAQIIASSGLIRKSQ
VENLSATFKTDVPQNYKMMDLHKQKASKLFRSGLF