Identifiers and Description

Gene Model Identifier

Contig20532.0.g99

Standard Name

MMS4

Aliases

Contig20532_0_g99

Description

PP-loop family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20532.0.g99(coding)
ATGGAAGAAGTTTTATCTCAGTACCAGCACTATCAATAATCCCAAGCTCTCTAGTCAGCT
ATGGATCAGTAAAAGTAACAAAACCTGCTAAAATAAAAAGCCAAGAACAAAACAGAGATA
TTTCACTTGCTATTGAACCACAACTTGAAGGATTTAGAGATCGCCACATTTATTGAGCAA
ATGCTTGAGGAAAAAATGATTACATATCAGTATTCAGCTAAGACTCTCACTAACTCAATT
TTATGGCTGTAAGCTAAACCTAACCCAAATTACAGTGAAGGTTTACAATAAAATAACATG
ACTTAATCTAATGGGTTCTCATTCAACTTAGCATAGTAATAGTAAATGCAAATGCAATAG
ATGGCTGCACAATATAAATATGACAATGAATTTGCAATGGTCTATCATAACGTTGATACA
TTTCAGTAAGATTACAAGAGAGGCTACTTACAACAAGAAATGCAAAGATTAATGAAGTAT
AAACAAATGAGAATTTCACAAGGTTCTAATGGATTTAAGGTCATTGTTCTATTTCATGGA
GTTTATGATTCACTATTCAATAATGAACCCTTAGGGCAAGAAACCTAAGGTGTGAAACAT
AATCAATTCAAAGATTAAACAAAGAAAGAATAGTTAAGATAAGATTGTATGACAGGAGAT
TTGACCGTATCGAAATCAGAGTATGATAAGTTTTTGATTGATCTCACAATAACATATCAA
TTTGATTACATCTAACTAGATTCCCCAATCGAAGTTATAGAGTTTCTGAAAGAAATGCAT
TAATCCATCGTGGAAAAACCTCATCGTAAGGAACTCTCAATGTACTCAAGAAAGGGTTTT
AAACCGGGAAAGAAAGCCAGCATGTGTGGATTCAAAGACCCCTAAAGCATAAATTATATC
TCCATGCTTATGTGCATTCCAGGATAACTTAATGGAGATGTTGATGAGTGA


>Contig20532.0.g99(protein)
MEEVLSQYQHYQQSQALQSAMDQQKQQNLLKQKAKNKTEIFHLLLNHNLKDLEIATFIEQ
MLEEKMITYQYSAKTLTNSILWLQAKPNPNYSEGLQQNNMTQSNGFSFNLAQQQQMQMQQ
MAAQYKYDNEFAMVYHNVDTFQQDYKRGYLQQEMQRLMKYKQMRISQGSNGFKVIVLFHG
VYDSLFNNEPLGQETQGVKHNQFKDQTKKEQLRQDCMTGDLTVSKSEYDKFLIDLTITYQ
FDYIQLDSPIEVIEFLKEMHQSIVEKPHRKELSMYSRKGFKPGKKASMCGFKDPQSINYI
SMLMCIPGQLNGDVDE