Identifiers and Description

Gene Model Identifier

Contig6775.0.g21

Standard Name

ML1a

Aliases

Contig6775_0_g21

Description

RNA recognition motif 2

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam04059 ) RNA recognition motif 2
  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007034707.997739975804982e-43RNA recognition motif 2 family
protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6775.0.g21(coding)
ATGACCAGAATTCCTGAAAAATCAAAGGGATCAGAGTTAATTACTGTACCTAGCTTTCAA
TTTTCTGAAATCAGTTCAACCTAAAATTCATTGCCTAAATCAAACTTATATCAAGGTAAA
CAGATCAGCCTACATCCAAAATAAAAAACTGACGGCCGCACATCTTCAATTTACAATTCC
TTAATAACTAAATCGATTTTGTTGAAGTAAAACCCATTGGTGGGATAAATGAACTCTCCC
AAATATTAACGAGGTATAAATGACTAAAAGTTCGAAGATCAGCATCCTTCAAAGTAATCG
AGTGGTCTTACTTTTGCAAAGACAAGGCTTCCAGTTTTCAAAGAGTTTTAAAATTTTGGA
CAAGCACAAATAACTTAAGCTGACTTGTATTAAACTAAGGATTATGCAGCTGTATCAACC
AAGGATGATGACAGTAGCGATGGAGACTTTGATAACTAAACAAGCAGCCCGAGAAAACAT
TAAGAGTCAAATTTTGAAGAAATAAAGCAACCAACAAAGCTGCAACACAGCAGTTCAGAG
AAATACATGAAAACTAAATTGGCTTTAAAGCCTTCTTCCAAAATTCTAAAGATTTACAAT
GTAACTGACTTGGTTATTTTGAAAGCAGAGTTAGAAAAGCTTGGCAATATAATATTTCAG
GATTCTCACTACCTTAATAAAAATGATTACATCGTAAAATATGAAAAACTGGATGAAGCC
GAAAGAGCCTATGAAATTTTATCTTTGAAATATACCATTGAATACATAACGACCCAACAT
AGTTCAGATGAGGCAACTTACTACCTAAGTAAACTAAGAGGAAACTTTGATTAATAAGAA
TAGGATGCTTGCTTGACTCTTAACATGCTTAAATTAAAGAATAATTCATATTAATAAATC
AATGACTTGTCTTCTCAAACATACAGGGGCTACAGCCAAAGTTTTACTTTTCCATAGAGC
TATTAGAATGAACTTGAAGTTTTCAATAATCAAATTGAAAATAATTCAATGTCTAGAAAC
GAAGGTCTCAGCATCAATTCAAATTGTTATGTTCCTACTAGAAATATCCCTCAAACAAAT
TTATCGAAAGGAATCAGTGTTGAAGAAGCTGTTCAGAGAATTTCTCTATAAAATGATTCT
TAAGATACTGTTTAAGACAATCAATATTAAACAATTCAGTAATAAGATAGAAACTATAAG
AATCAAGCTGAACAAATTCAAACCTAAGTTGACTTTATTAAGGCTGATTAAAGTCTCCAA
ACTAAACAGATTTAATCAATTAATTTTGATTAAGCTTATAATAGCTCAGCTGAAAGTTCT
TATAATCATAACTCGGGATTTAAGATAAACTTAAATAACATCCTGAACTTTAAGGACTAA
AGAACTACTATAATGATAAAAAACATTCCTAACAAATATACTCAAAAGATGTTACTTAGT
AAAATTAACGAAAATCATAGAGATAAGTATGATTTCTTCTATCTCCCTATAGACTTTAAG
AACAAGTGCAACGTTGGCTATGCATTTATAAATTTTGTCGACTCAATTTTCATTTTGAAA
TTTTTTGAGGAGCTAAATGGAAAGAGATGGGAATGCTTCAATAGTGAGAAAGTTTGTGAA
ATAACCTATGGTCGTATCTAAGGCAAACATTAATTAATTGAGCACTTTGATACCTCAAAC
CTATGGTTTTCAAGTGACAGAAAAGTAAAGCCACTCATTTTGAATGTTGTTTAACCTAAT
GCCAGTTTCGTTAAAGACTACAGAAAGAATCTTATGGTTCAGTTTGGAAGTCAAAGTGAA
ATACAAACTATGAAATTTTAATAGAAGAATGGGGACCATAGCAATTCAAGACAATATGAA
AGTCAAGGCTAGCAAAACAATTCTAGATAAGTCACTTATTATAACAGAAACTATTGA


>Contig6775.0.g21(protein)
MTRIPEKSKGSELITVPSFQFSEISSTQNSLPKSNLYQGKQISLHPKQKTDGRTSSIYNS
LITKSILLKQNPLVGQMNSPKYQRGINDQKFEDQHPSKQSSGLTFAKTRLPVFKEFQNFG
QAQITQADLYQTKDYAAVSTKDDDSSDGDFDNQTSSPRKHQESNFEEIKQPTKLQHSSSE
KYMKTKLALKPSSKILKIYNVTDLVILKAELEKLGNIIFQDSHYLNKNDYIVKYEKLDEA
ERAYEILSLKYTIEYITTQHSSDEATYYLSKLRGNFDQQEQDACLTLNMLKLKNNSYQQI
NDLSSQTYRGYSQSFTFPQSYQNELEVFNNQIENNSMSRNEGLSINSNCYVPTRNIPQTN
LSKGISVEEAVQRISLQNDSQDTVQDNQYQTIQQQDRNYKNQAEQIQTQVDFIKADQSLQ
TKQIQSINFDQAYNSSAESSYNHNSGFKINLNNILNFKDQRTTIMIKNIPNKYTQKMLLS
KINENHRDKYDFFYLPIDFKNKCNVGYAFINFVDSIFILKFFEELNGKRWECFNSEKVCE
ITYGRIQGKHQLIEHFDTSNLWFSSDRKVKPLILNVVQPNASFVKDYRKNLMVQFGSQSE
IQTMKFQQKNGDHSNSRQYESQGQQNNSRQVTYYNRNY