Identifiers and Description

Gene Model Identifier

Contig17611.0.g85

Standard Name

MIZ1

Aliases

Contig17611_0_g85

Description

MIZ/SP-RING zinc finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003484905.998633383648922e-18MIZ zinc finger family protein
SGDYOR156C0.000000005997038937208364NFI1 SGDID:S000005682, Chr XV
from 630540-628360, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17611.0.g85(coding)
ATGAATAATTTAAACGGGAATAATCAGGGGTTTCACAACAATCCAAATGGAATATTTGCT
CAAACTAATCCGATTTCAAGCATAAAACCAACTCCATAAGTGGGACGAATTGCTAATGGT
ATGGGAATGACGCCTATGTAATAGTTTAGTGGAAGTAGTTTGAGTAATCCGCAAGAATCT
GGAAGTAGCAGTGCAATCGATGACCCAACTCTGAACCAAGATGTAATTAAGTTTCTGCTC
AAACTCAAAAATAATAACATTCAGAATCTTAAAAATGCACTTAAAAAGCTGGGAGAAAAA
ACAGTGGGTAACAAGGAGAATCTTTTGCTTAGATTAGCTAAGAAACTGGCTACTGAGCAA
GGAAGAAACTTAGTCAGATAGAATTTTAAGCCTGAAGTGTATCGACAGTTGTACGAAGTA
GATATCAATGGAAACTACCAGCAAATTGCTCAATAATCAGGAATTAATTAAATAATTTAG
AGAGGTTCTTCTTAAGTTTAGGGACAATCTGTAATACCTCCTCAGCCATAGAACTAATAA
AATAATCGAAGATACTTGAATCCTACTGATTCTTAATTTCAAGGAAGTAACATGGTTCAA
AATAGTTTCACTTAAAATTACAATCCCAGTATCATTCCAGGGCAGAGTCATATTCCTTTT
ACATAGCAACCGTAATCAAATGGATTAGTTATGTAAAATGGAATGAATTAATCTTTTCAA
TAAAATAGTAGAACATAACAGTAAAACTAAAACAGAAATTCAGTAGACGTCATTGAAATT
GATTCTGACACTCCAGAGAAATCAAACTCTCATAATAATATCGGTTAACATAATACTTTC
AACAATTAATAAAACAGAGTGTATGCAGGAGTGATAAATTCTTAGGGTAATGATATAATG
AGTGGTCAAGAAGGCTCTTCAGCAAACAAATCAATGTATTCTCTATAATATCAAGAAATT
ATGACATAGAGTAATTATCCATGCATTTTAGACGAGTCTAATTAGCAAAATAAATCTTAA
GTTCAATGCATTTGCGATAATCCAAACAGCTTGTACTACTCTGGATCTAATTAATAATAA
CAGTAAATCTTAAAGACTTGTAGTAACTGCGGAAAAGATTAACATCTTAATTGTTTAGAT
GACAATAAAAACATGAGAACAGCTCAGTAAGGAGGGCAATAACTGTACGTTTGTCACATG
TGTCAATTTATGTAAATAGATCCTTTCGCAATCCCTATTTTTACCTTACTCCGACCCTTT
AAGATCTCTAAGTTTACTACTTAATAAATCAGAGCCAAAGATAATAAGTTTGCAAGAGAA
TTTGTGTTTAGCGAAAGGCATGCCCAAGAAATCTTCAAATATAAAAATCTCTCAGATTCT
CCATTGAGAGTTTAAATCAGATGTATAAGATTAGATGGTGTAGGATATGAGCACTGTTTC
CCAAAATTTGGTCAACTAAGCTTCAACAATGATAATCCAAAAAACTTTATGATATAAGAT
CCACCAAATGATACAAAGAAAAGGAAGGATGATATCCTTGATATTACCAGTATGATCAAA
AGACCTAAGAACAAGATTGAATTTTATTAAGAGTAGAAAAATTTCGATGGTTACTTCAAT
CATCCAGGCCATGTTTGTGGGATTTTTATAGTGAAGATAATATAACCATATGATGTTATC
AACTTTATTTCAACTCAAAGAATAGAGCAAGCAGCTGTGAGTTTGTAAAGAGCTGACTAA
TTCTTTGGTAAATCCTCAAATAATAATGATGATTAAGATATTTGTGAAATTGAAACAGAG
ATGGCCCATTAAGTAAGCATCTCTACACTTTGCCCTATAACTCGTAAGCCAATAAACAAT
CCTGCAAGAGGTGAGCTCTGCAAGCATTTGGACTGCTTTGATCTTGAAACATATATCAAT
ATGAACCACAAGGCAAAACGTTGGAAATGTCCTTCCTGCAATAAACGTGCTCATGTCTTG
AACATTGATCCTTATTTCTAGAAAATTACAGATCTCATGGCTAAAACTCGATAATTCGAT
CCAAAGATTTACGAAAAGATTCAAATTGATTCAAATCTCACAATTACTATTAAGTCGAGT
AGCAATGATGATAAAGAATGGAACTACAAATTGACTCGAGAATCTTCAGACACTTATTTC
TATGACATGGAGAATGTATTAATTATCGACAAAAGCGATCTGCGAAAGAAATTGAAATCT
GACTGCGAAGACCCCAATAACTTGAATTAAATGCACAGCAATGGAAACAGTAATAGTGCA
AACGGCAACAATAATTGCAGCGGCTCTACCACAGCCTCGTCAGGCAGCATTGAAGGAAAT
ATTAGTTCAGTTACTACAAGCAGTAGAAAGAAGGAGCCAGCTGAAGCTATTTGTCTGGAT
TCTGACGAAGAAATGAACTGA


>Contig17611.0.g85(protein)
MNNLNGNNQGFHNNPNGIFAQTNPISSIKPTPQVGRIANGMGMTPMQQFSGSSLSNPQES
GSSSAIDDPTLNQDVIKFLLKLKNNNIQNLKNALKKLGEKTVGNKENLLLRLAKKLATEQ
GRNLVRQNFKPEVYRQLYEVDINGNYQQIAQQSGINQIIQRGSSQVQGQSVIPPQPQNQQ
NNRRYLNPTDSQFQGSNMVQNSFTQNYNPSIIPGQSHIPFTQQPQSNGLVMQNGMNQSFQ
QNSRTQQQNQNRNSVDVIEIDSDTPEKSNSHNNIGQHNTFNNQQNRVYAGVINSQGNDIM
SGQEGSSANKSMYSLQYQEIMTQSNYPCILDESNQQNKSQVQCICDNPNSLYYSGSNQQQ
QQILKTCSNCGKDQHLNCLDDNKNMRTAQQGGQQLYVCHMCQFMQIDPFAIPIFTLLRPF
KISKFTTQQIRAKDNKFAREFVFSERHAQEIFKYKNLSDSPLRVQIRCIRLDGVGYEHCF
PKFGQLSFNNDNPKNFMIQDPPNDTKKRKDDILDITSMIKRPKNKIEFYQEQKNFDGYFN
HPGHVCGIFIVKIIQPYDVINFISTQRIEQAAVSLQRADQFFGKSSNNNDDQDICEIETE
MAHQVSISTLCPITRKPINNPARGELCKHLDCFDLETYINMNHKAKRWKCPSCNKRAHVL
NIDPYFQKITDLMAKTRQFDPKIYEKIQIDSNLTITIKSSSNDDKEWNYKLTRESSDTYF
YDMENVLIIDKSDLRKKLKSDCEDPNNLNQMHSNGNSNSANGNNNCSGSTTASSGSIEGN
ISSVTTSSRKKEPAEAICLDSDEEMN