Identifiers and Description

Gene Model Identifier

Contig6175.0.g60

Standard Name

MG2D1c

Aliases

Contig6175_0_g60

Description

Prenyltransferase-like

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6175.0.g60(coding)
ATGAAAAGAATAAGTTCATTAGGTTCTCAATATCAAAATATCTCAAATGCTTTTATTGTT
TGGGTTTTAGTAGAAAGTGGAATATCCTAAAATTTGACTACAGATATATAAAACTTGTAT
AAATTTGTTGATAATATGATTTCTACAACAGCGAAGCTAAAAACTGCAGACGCCTATCTT
TTAAGTTTAGTTTCATTAATTGCTTATAAATCCGGAAATACTGCTTTTGGACAGAAATAT
GCAGATGCCTTGAAAACCAAATAAAATTCATTAGATGGCAGTATTTAAGGTAGTTTAAGC
ACTTACTTTCTAAGTTACAATCAAAGCATGAATTTAGAAACTACATCATTATCAATTTTA
GCTTGGTAGTATAACACTTAAAGGTATTTGAGTAACATTCAAAAGGGTGTTGACTATATT
CTCAAATAAGTTAATTAAGATGCTTGCTACACTTAAAATCTAAGTTTTACTGATACTATC
AGTCAAAAAGCATTAGCATAGTACCTTGGTATTAATTAACTAAGCTTTTCAAGCGGAAAT
ATTTAGTTAAATTATGGAGCTCAAACAAAAGACTTGACAAGATTTAATAACTTGACTTTT
GAAGCAATGAAGTTTGATATAACATCGCTTTTGAAAACGCAGACTTAAATTTAACCTTAG
TTATAGATTAATTTGTCTAATTTAAAGAATACCCAAACGAAATTGGTTAATGGTAAGACT
CAAACAGTTTCAGAGAACTTTACTTTCTTCTACGAATTAGAAATAAATTATGCTGAATCA
AAAGCAAAAGATTTGTTAAATACTTCAACTCTTCTTGATTTATAAGTAATTTCTACTTCA
ATAGATCTTACTAAACTTGGTACCTAACCTCTCCTTAATTAACCAATAACATTCAAGGTT
TCACTTAAAAATAAGCTTAATTATATCTTGAATAATATCTCAATATACCTGCCAATACCT
TCTTGCTTAGAAATTGACAACTCAAGCATCCAGAGTTTAATAATCAATAATAAAATTGAT
TAATACTATATAAAAGAAACCACAGAAACCAGAGAAATTGTGCTTAATTTAGATAATTTG
GATGGAAGTTAAACATTATAATTTCCAGTTGGGTTTATTTAGAAGTATATTGGAAAGTGT
AGTATAGATAAGATAAATAGAGCAATGTCTCAAAATAATAAAGATCAAATTGCATACTCA
TAGACTTAAAATATTAAATGA


>Contig6175.0.g60(protein)
MKRISSLGSQYQNISNAFIVWVLVESGISQNLTTDIQNLYKFVDNMISTTAKLKTADAYL
LSLVSLIAYKSGNTAFGQKYADALKTKQNSLDGSIQGSLSTYFLSYNQSMNLETTSLSIL
AWQYNTQRYLSNIQKGVDYILKQVNQDACYTQNLSFTDTISQKALAQYLGINQLSFSSGN
IQLNYGAQTKDLTRFNNLTFEAMKFDITSLLKTQTQIQPQLQINLSNLKNTQTKLVNGKT
QTVSENFTFFYELEINYAESKAKDLLNTSTLLDLQVISTSIDLTKLGTQPLLNQPITFKV
SLKNKLNYILNNISIYLPIPSCLEIDNSSIQSLIINNKIDQYYIKETTETREIVLNLDNL
DGSQTLQFPVGFIQKYIGKCSIDKINRAMSQNNKDQIAYSQTQNIK