Identifiers and Description

Gene Model Identifier

Contig2721.0.g84

Standard Name

MG2D1b

Aliases

Contig2721_0_g84

Description

A-macroglobulin complement component

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( pfam07678 ) A-macroglobulin complement component
  • ( pfam01835 ) MG2 domain
  • ( pfam10569 ) Alpha-macro-globulin thiol-ester bond-forming region
  • ( pfam07703 ) Alpha-2-macroglobulin family N-terminal region
  • ( pfam02752 ) Arrestin (or S-antigen), C-terminal domain

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2721.0.g84(coding)
ATGACACGTAGTCGTATCAGATTCCCATAATTTAACAGAATGAAAACTAATCTCATCCTG
TTGACACTTATGAGTTTATACTTTGGTGCAAAGTCTTTGGAGTTTGCACTACCAGATTAG
AAAATCAGGGCTCCAGAAAGAATGCCGTAACCTATTGAAAGCCAAAATCAAAGAATTTTA
GCACATATTCACACGGATAAACTGATATACAAGCCAAATGATGTCATGTTTGTTGAAGTT
TTTTTGTTCGATGCAATGACAAAGCAACCAGTAACTCAAATAGAAGGGTAAAGCCTAGAA
GAAACTCTTTATCCAGCTGTCTTCACTATAAAGGATGACAAGGATAATTAAGTTTACCAA
GATAGTTCAAATTAAGGCGCCAATGGCACTTTAGTTTACACTTTCAAAGTTCCTGAAGAG
TAACCTGGTGGTGAATATACTTTAGAGATAACTTCTTATCTCTTCCCTACTCAATAGAGA
AAGATAAGATTCAGATCTTACGGTGAGAGAAACTTGTTCAATACTGTTGACTTTTCAAAA
GACACTTACTCTCCAGGAGATTAAGTGCTTGCCAAACTTAAAGTTAGGAGATCAGATTCT
TAGAAACTAAGCCAGGATACAGTTATATCGTACTCAGCAAACTTTGAATATAACTCTATA
TCAAAGTAAGACTTGAAGCTAGACGTATCAGGGGAGCTGATAATTGAGTTCAACATCCCC
ACAAACACAAGATAAGATTTATTAACACTTGTAGTCCAGGTTACTATCCCAAATTCTTTT
GTTGAATCATCCGTTCATTCAACAGTCATTGCTCAAGAAAAAGAATTGACAATAAGATTC
CATCCAGAAATTGGCTTCTTAGCTGCTAACCAAGTAAATATTTTGTATTTTGAATGCCTC
TCTGACTCACAAGGTACTGATGTTGCTGATTTTTATGAAGGTTCCATAATCAGTATAGAT
TAAGATGGAAAAGAGAAAATTATTTTTGACAACTTCTAAATCCAACCTAGACATCAAGGA
AAAGGGAAAATTTCTTCATTATACATTCATGGAAATGAAAGTCTTATCTACTTCATGAAA
GTTAAATGGACAAAATCAAGCCAATTTTAAAAATACTTGTTACCAAAAATTGATGATTCT
AAGTAAGCTTTATTCTCAGTAGTTCATCCAGTCATTAATCCCAATAAAAATGAAACTTAT
ATTGGAGTTTTAATTGTTGAACATAATGATGGGCTTTCACATAATTATTAAGTAAATATC
TAGCAAAAAGAGAAAATTTTGGCAACATATGATTTCAAGTCAAACAAAGAATTGAATCAT
TAAGAGATTAAATTCCCTTTAAATGAACTTCCAAAGGAAGTAGTTAATAATGGAGGAATA
TTTTAAGTTACTATGTTCAAGAAGGAAGTGGAGCTGGTTGCGGGAGAGAATCATACTTAA
TTAGTTAAAAATGGCGAAAGACTTATTTTTATTAGACCCAAGGAAATTCTGAATGTTTAA
ATTGAGATGGACAGAGTAGAGTTTACTCCAGGGGAAAGTATAAGCTTTAATGTCAATTTA
CTCAACAGCAATCCTGATGATGCTGCATTTTATAGTGTGGTTGTTACAGACGAAAGCTCA
TTCATTGAAGCTCCAAAAAGAGCGAATCAACCTTCCCTCTTAGCTATGGTACTCCTCGAA
AACGAAATTTATCAAACTTATGACTACCTTCTTGGTGTTTAAAGTTGGAGAAGATACATC
TTCGTAGAGGAGGATTTAGCACTACTTAAGAATAGACTGTATTCTATGGATGAAAAAGAT
CCAGAAAAGTTGAGACTATAAAGACTACTTGCAGAGAAAGATCAACCCAGATTCTACATG
ATGAAGAGAGGTGGTGTGAGGCAAGATATCAAGTTTAAGAATTTCGATAATGTAATTGCT
GAAGACGCCATGGAAATTATGGAAATGGCTTCTCCAGCAGTCTAAGATATAGCTTTTGGA
GGGGCAGTAGTTAATGGGGCTGACTCAAAAGATGATGATTTTGTTGAAGATAGCTAAATT
TAAGAACCAAGTAATGACACCTCAAATGAGATCTAAACTGATTTCATGCAAGATATATAA
TAAAACACAAGAAACTACACTCATCTCAAGAGTAGGAAGTAGTCATTAAATGATTAAAGA
CTGGATTTTACTCAAACCGTGAAATTTGTTTCTGCTCAACCTTTCTTGGATTAAAACATG
ATAAGTTTCGACCTAAATGACTAAATAACTACATTTAGAATAACTGTTTAAGCTTTCAGC
AAATCAGGAGATAAGCTCTATATACCTCTATATGTTGTAAATAATTTGGACAAAGTACTT
TCTGTAAATCTTGCCATTTAAGATACTAACAATGCTGGATAAAAGAAAGTTAGAATGTTT
ACACTTTAACCTTATCAAAGTCATACTGAAAAGTATCTACTAAACACTGATGATAGATCT
AACGATCATAAACAAATTTTATCAGTTCAAGTGTCAGCAACAGATTCTTAAGGAATCAAG
TATGAAGATAGTCTTACTAAATTTTCAGAGATATTGCCAAATGGATTCACTCAAAAGTTT
TCTTAGAGTGGGTTGATTGGTGTGAGCCAAAATTCAGAAAAGAATTTAACCTTCAAGTTT
ACACTTCCAGAAACTTATCTGGACAAGACTTTGAAAGTTTCTGCAGCCAAGATTTTCTCG
GAACCCCTTGACAATATCCTTGCAGCTATTGAGAGTTTGATCCAAGAGCCCTATGGTTGT
TTTGAGCAATGCTCATCTGTAACTTACCCAATAATTATGGCACTGTAATTCTTGAAAAAA
GCTGAATAAGGTGCCAAAAATTAAACTTAGAAAGACCATATCAAGCAATTGATGTTAGAG
GCAAATCAGAAACTAGAAAGAGGTTATAAGAAGTTACTGACTTACGAATCAACTAATGGT
GGTTATGAATGGTTTGGAAACAACCCAGGACATGAGGCATTATCAGCTTATGGACTTATG
TAATTTAATGACATGAAGAAAGTTGCCCCTAATTAAGTCGATGATTCTATGATGACAAGA
GTGCAATAATGGCTATTTGAAAGAAGAGATGGCAAAGGTGGCTTCTAATAAAGTCAATAA
GCTCTTGATACTTTCGGCGGAGCACCTGTCAACATTACAAATGCATATCTGGTTTGGGTT
CTATCAGGATTAGGTTACAAAAATCTTACCTAAGAAATAGATGCTTTGTAGGAAACTGCT
AAACACACTGATGATCCTTACTTTTTGGCTCTACTCTCTGGCTCTTTGATTAACTTAAAC
AAGAAAAATATAGTCAGTCAATATTTAGATAGGTTAGCTCAAAAGCAAAATATGACAAGT
GGAGCTGTACAAGGTGCAGCTACATCCATTACTAGCTCATGTGGGCAAAGTTTATTGATT
GAAACCACTAGCTTAAGTTTAATAGCCTGGTTAAAGCATAGTAGAACTCAATATGCTCCT
AACATTGAGAAAGGAATTAAATTCTTGATAAGTTCAATTTCAGATGGAGGGAGAATGGGA
TCAACCTAAAGTACTATTTTAAGTTTGAAGGCATTAATTTTGTACATGGAAGAGTACTCA
GGTATTCAAGGCAAAGGAAAATTCAATCTATATATTGATTAGAAATTAGTTAAGTCTTTG
AAATTCGATGAAAAATAAACTGATAATCAAGGTTCATTCGACTTCGCAAATGATATTTAA
TTATTCCTAAACAATTATGGATCAAAATTAAGAGAACATGTGATCGAAATAAAAATAGAA
GAACTTCAGTCCTATGGTGAAGTTAGTTAAGATTTCTAACTTTCCTACACTCTCTAAATT
GATTATCTGGATTAACACCCAGCCTCAGCTCCAAACCCAAAGATTGAATTCTATCTATAA
CTTAAGGAGGCTGCTTCCCAAGGTTTAACTCTTGGATAATCAACCCTCTCAACTGTAACT
CAGCACATAGAAATCATTAATACTTCAAAAGAGCCACAAGGAATGGTTGTTGCTATAATC
AGTGTACCTTCATGCTTGAAGCTTGACGTCAACTAATTTGAACTTTTGAAACAGAAAGGC
AAATTTGATTCATACGAGATATCAAGTGATTTAAGTCAATATACACTCTATTGGACTTCA
ATTAAACCACATGACATTAATAGTAAAAAGTTCAATAAAGAAGCTGATCTAACTTTGGTA
AAATAATTTGACAGCGAAAATTGTTAAAACAGAGCTAGTGTTGCCTACCTATACTATGAC
GTTGAGAATAAAATTTGGATTTGA


>Contig2721.0.g84(protein)
MTRSRIRFPQFNRMKTNLILLTLMSLYFGAKSLEFALPDQKIRAPERMPQPIESQNQRIL
AHIHTDKLIYKPNDVMFVEVFLFDAMTKQPVTQIEGQSLEETLYPAVFTIKDDKDNQVYQ
DSSNQGANGTLVYTFKVPEEQPGGEYTLEITSYLFPTQQRKIRFRSYGERNLFNTVDFSK
DTYSPGDQVLAKLKVRRSDSQKLSQDTVISYSANFEYNSISKQDLKLDVSGELIIEFNIP
TNTRQDLLTLVVQVTIPNSFVESSVHSTVIAQEKELTIRFHPEIGFLAANQVNILYFECL
SDSQGTDVADFYEGSIISIDQDGKEKIIFDNFQIQPRHQGKGKISSLYIHGNESLIYFMK
VKWTKSSQFQKYLLPKIDDSKQALFSVVHPVINPNKNETYIGVLIVEHNDGLSHNYQVNI
QQKEKILATYDFKSNKELNHQEIKFPLNELPKEVVNNGGIFQVTMFKKEVELVAGENHTQ
LVKNGERLIFIRPKEILNVQIEMDRVEFTPGESISFNVNLLNSNPDDAAFYSVVVTDESS
FIEAPKRANQPSLLAMVLLENEIYQTYDYLLGVQSWRRYIFVEEDLALLKNRLYSMDEKD
PEKLRLQRLLAEKDQPRFYMMKRGGVRQDIKFKNFDNVIAEDAMEIMEMASPAVQDIAFG
GAVVNGADSKDDDFVEDSQIQEPSNDTSNEIQTDFMQDIQQNTRNYTHLKSRKQSLNDQR
LDFTQTVKFVSAQPFLDQNMISFDLNDQITTFRITVQAFSKSGDKLYIPLYVVNNLDKVL
SVNLAIQDTNNAGQKKVRMFTLQPYQSHTEKYLLNTDDRSNDHKQILSVQVSATDSQGIK
YEDSLTKFSEILPNGFTQKFSQSGLIGVSQNSEKNLTFKFTLPETYLDKTLKVSAAKIFS
EPLDNILAAIESLIQEPYGCFEQCSSVTYPIIMALQFLKKAEQGAKNQTQKDHIKQLMLE
ANQKLERGYKKLLTYESTNGGYEWFGNNPGHEALSAYGLMQFNDMKKVAPNQVDDSMMTR
VQQWLFERRDGKGGFQQSQQALDTFGGAPVNITNAYLVWVLSGLGYKNLTQEIDALQETA
KHTDDPYFLALLSGSLINLNKKNIVSQYLDRLAQKQNMTSGAVQGAATSITSSCGQSLLI
ETTSLSLIAWLKHSRTQYAPNIEKGIKFLISSISDGGRMGSTQSTILSLKALILYMEEYS
GIQGKGKFNLYIDQKLVKSLKFDEKQTDNQGSFDFANDIQLFLNNYGSKLREHVIEIKIE
ELQSYGEVSQDFQLSYTLQIDYLDQHPASAPNPKIEFYLQLKEAASQGLTLGQSTLSTVT
QHIEIINTSKEPQGMVVAIISVPSCLKLDVNQFELLKQKGKFDSYEISSDLSQYTLYWTS
IKPHDINSKKFNKEADLTLVKQFDSENCQNRASVAYLYYDVENKIWI