Identifiers and Description

Gene Model Identifier

Contig422.1.g112

Standard Name

MG2D1a

Aliases

Contig422_1_g112

Description

Alpha-2-macroglobulin family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig422.1.g112(coding)
ATGCAGTCAAAATAGAACCCAAACAAACTGGGTATCTTAGCAACTCTGCTCACTGTTTCA
ACCCTCGCCACCCTTTCATCGGTTCAGTCCAAATTCCTCTTTGAAAGGCTCTCATTCAAT
CAACACAAAGCAGCCAAGAATCCCGTCCTTGTTAGTGATTCTAACGTTCTTGCATACAAA
GATACACCTTTGTTGCAGCAATCAGCTTCGGCAGCTGTTAACTAAAGTATCGTTGTTTAC
AATCTATCATGGTTGAATACCCAGAGCGTCAACGCCACCGATGATTTCATCAACAACACC
AACCCCAGACTTCAAACTAGTATCAGACTTGACAAAGAAGTATACGGACCCAGAGACGTC
GTCTTCGCTGAGGTTTTACTTCTCAATGCCCTGAACAAGACTCCAGTGGCACTCAGCACT
GTTGATCGCACAATTTAATAATATTATAATCTAACCCTAGAAATTCTTGATACAGGCAAT
AATATTCTCTACAATACAACTGTTCTTGCAGGAAACTCATCCGCTGCATTAGCTTACAAA
ATCAGTGATACCCTTCTCGCTGGTGACTATGTCGTTAGAGCCTACAATCAATTCGTTCCA
GTGACATCTACGTCATTCACAGTTCGCACAGCTTTGGCAGATCCCGCTATAGTAAGTATC
TAACTCCCTCAACAGACATACAGTCTTGGAGAAACAGTTAGAGGCATTGTAAAGATTAAC
CTTATCAACGGACTCTCACTCCCAATCGGTGCTCTTACTACCTTCAACGTCAGCTTCGGT
AACTCAACTGTCGCTAACACTTCAGTCACCCTATCCCTAAGAGGAGATGCTGTTTTCTCA
TTCGCCATTCCTAGATATGCTGCCACTCAGACTCCAACAATCGCTTTCACCGTTAGAGGA
GTAAATTTGACTTACGTTTACTTACAAACTTTCCAACTAGTGAACCCAGATCTTTTAACT
ATTGATTTCTACCCAGCCACTGGTTACCTTACCAACAACGTTCCAAACACAATCTATTTC
CAAGCATGGACCAACTCATTGAAAAACGAACCACTCGACGTTACTGGAGCAACCCTTAAG
CAAAAGGTTAACACTTCTGCAGAGATTACCCTCATCAATGGAGGTATCAACACTGTTGCC
AAGGGTAAGGGATCTTTCCAATGGACCCCAATTACTGCCACTGGTTCTCTCGCCCCAGTT
CTTGAAGTTGTTATTAATGGAGTTACCATCAGAAGAAGCGTTACCTTCACTGCCAGCGCT
TTCCAACCAACAACTTCATCAGAAGTTAATTTCAAGATTCTTAACGACAACAGATTCCTC
GCCAACAACGAAGATCTTAGAGTTCAACTTATTACCAACGCCACTGTTAATGCTTCAGAG
ACATACGTTGTTTAAATTAAGAACGCAGAGACTGTCATCTGGTAAGACCAATACAACCTC
TTCGCCAACTCAACCAGAAACATTACCGTGACTGCTAGAAACTTCTCCGTTGTCAATGGA
GGTCTCCTTTCCGTCTCAGTCAATAAACTTACAAGAAACCTCGAGAACTTCTACAAGAGC
AGACCAGCTGTTGTTCCACCAACCAACACCACCAATGCTACCAACGGTACCAACACTACT
ACCAATGTCACTAAGCCAGCTGCCACCACCAACGCTACCACTAATGCTACTAACGCTACT
AACACTACTACCAATGGAACTAACTCCACCAACACCACCACAGGCCCAGTCGTAGTTGTA
AGAACTTTCACTTTCACCCCACCCGATTTCGCTAACACCACCATCACTACTTCTTTCTTC
GAACCAAAGGGTGAGTTACTCTTCTTCAAGAGACCAGCTGATGGACTTAGAGTTTCAGTC
ACTTTCGATAAGCCAGTTGCTTACCTCCCAGGTGATACAGTTTCATACACTGTCAGCATT
GTTAACATCACTACTGGAAGACCAGTCACTGTTGACTCTTACGTTACTCTCTCAATTGTT
GATGTTGCCGGTATTAACGGTGCTCACGGTTCATCCCTCGCTGCCAGATCATATCTTTCA
AACTAAATTAAGAACTTCGATAACGAAAACCTCATTGCTCAACCAATCCTTACCAGCATC
TTCTCTGGTGCCAACAACGACACTAGATACGTCGATGTGTTGCTTGGAGTCCAAGGATGG
AGAATTGGTGCTTTTGACGTTAGATCAATTGTCAACACTGCCACTATTCTTAGAACTGCA
TCACCAGCAGATTAACAAGCCATCCAAAGCTTGTACAGCGCTGTTGTTGTTAACCAAACC
AGACCAGTTGCCACCGTTGTCAGACCAAACTCAGCCAGATCAGGAAGACAAGCCAACGAA
TCTACCCCACAAGACTTCATGGGTAACCTTACTAACCCCAAGGCATTCGCTCACCCCAAG
AGAGCTGGATGGACACCAGCCCAAAAGATTGACTTGACCTAAACCGTAGCCTGGAGTTCA
ACTGTTGTTGCTAAGGCCGGTACCCTCAAGGGATCAATCGTTCTTAATGATGCCCTCACC
AGCTACAGCGTAGTTGTTGATGCCTTCAATGCCTAAGGAGCTGTTGGTTCAGTCAACGCC
ACCATCCTTACCAGAGACTCACTCGTTATCTCATACACTCTTCCAAAGTTCATGGTTGTT
GGTGACTCCTTGAAAATCCCAGTAAGCATTGCTAACCAAGGTTCAGCTGCTCTCCAAGTC
AAGCTCTTCGAGACTCTTAGTGATGCCAACCTCAGAGTTGTTGTTCCAACTGCTGCCATT
AACCTCGCTGCTAATGCTGCCGTCTCTTCATTCGTTACTGTCACTGCCTTGACCGAGAAA
TCAGGTGCTGTTCTCAACATCCTTGCTAACGCCACTGTTGCTGGTGTCACCTACTCCAAC
GAAGTTAGTGGCTCAGTATCAATTGCCGCAAGAGACTTCATCTACAAGACCCAAACTAGA
GGTGGACTCATCGGTTCAACTGCTAAAGCTGCCGGTACTGCCAACACTGCCGTCTTGAAC
GTTGACATCCCAGCTGACTCAAACTCAACTGGTCAACAATTCAGCATGACTGTTTACCCA
ACTTTCTTGTCACTCGTTGAATAAGCCAGAAGATCACTCGTTGCTGGTCCACAAGGAAAC
TTCGAAGAATGGTCTGCCACCGTCTACCCATTAATCCACAGATTGACCGCACTTAGAAAC
GGAGTCCAAAACGCCGACGTCCAAGTCCAAATTGTTCAACTCACTCAAGATATTGTTGCT
CAATACAACTCACTCCTCACCTACAGAATCCAAGAAGGTGCCAACTTCAGATTTGAAGGT
CAAGATCTCTCAACTGAAGCAATGACTGCTTACGCTCTCATTTTCTTCACTGATTTCGCT
GTCGGAAACACTTTCGTTGATGCTAACTTCTTGGTTGGTCTCCAAAACTATCTCCTTAGC
AGAAAGAACAACAGAGGTGGATTTATCCAATCATTCTCTGCCAACAGCGTTGGAACTCCA
ATTCCTCAAATCACTCACGACGCCTTCATCATCTACGCTCTCACCTATTACAGTCAAACT
GTCAACGTTGCTACTGAAATCCTTAACTTGAAGAGTGCTGCTGATAACCAAATCTCTGCT
AACAGAGTCGACTCACACCTTGTTGCTCTTCTTGCTAACGCTTTGTACAGACTCAAGAGA
ACCACTGAAGCTCAAGTTTACGCTGATGCCCTCGTCAAGGCCCAAAACATGGATGGTTCC
CTCATCATCAACAATGCCGCTGCTACCTCATTCAATGGTGCCAACGGAACTGAACTTGTT
CTCCAAACTACCTCACTCGCTGTTTTCGTTTGGAATAACAACCTTTCAAGATACACCTCA
TCAATCACCAACGCAACAGGTTTCTTGTACTCCAAGATTAACAATGGTATGATCGGTTCA
TCCGTCGCCACTTCATTCGGTCTTAAGGCTGTTAGCACCAACTTCGCTACTTTCAGCACC
ATCAACGGAAACGGTATCTTTACCGTCTCAGTTAACGACCAACTCGTTTCAGCTGTTGCC
TTCTCCCCATCCAACACTGATGCCATCAACATTGACCTCACTCCATTCGTCAACAACAGA
AACAACTCAAGAGCCCTCGCTCCAGGTCAATCCCTTGTCATCTAATTGTCTGTTGTGAAT
GTAACACTTCCAACTGCTGAGAAGAAAGACTTCAGATCTATCTACTCATTCAACCACAGA
TACATGGCCAACGCATCATACGTTCCACCCCCTCCCGTCAACACCACCCCAGAGTTCACT
GTTACTCTTACTGTTGGCAAGACCCCAGTTGGACTTGATGCCCAAAACGGTAAATTCTTC
AACTACACTGTTTCAGCTAAGAACATTATGATCCCAGGCTCATCCGCCTCAGGTCCAGTT
AACGTTGTTCTCGGAAGTCCATCATGCCTCGAGCTCGATGCCGCTTTCGCAAACAACCTC
ATTAACTCCGGTGCCATCGTCGGTTGGGAAGTTGTTGACAACGGTCTCACCGTACTCCTC
CTCAGATCATTGAATGCAGGTGAAACCAGATCAATCAATGTGCAATACAGACAAACCTTC
TCCGGTGCTTGCACAGCCAGAGACAACCTTGCCTATCAAGCTAACGGTGACTTTGAAATC
GCCGCCAAGACCAGAACCGTCTGA


>Contig422.1.g112(protein)
MQSKQNPNKLGILATLLTVSTLATLSSVQSKFLFERLSFNQHKAAKNPVLVSDSNVLAYK
DTPLLQQSASAAVNQSIVVYNLSWLNTQSVNATDDFINNTNPRLQTSIRLDKEVYGPRDV
VFAEVLLLNALNKTPVALSTVDRTIQQYYNLTLEILDTGNNILYNTTVLAGNSSAALAYK
ISDTLLAGDYVVRAYNQFVPVTSTSFTVRTALADPAIVSIQLPQQTYSLGETVRGIVKIN
LINGLSLPIGALTTFNVSFGNSTVANTSVTLSLRGDAVFSFAIPRYAATQTPTIAFTVRG
VNLTYVYLQTFQLVNPDLLTIDFYPATGYLTNNVPNTIYFQAWTNSLKNEPLDVTGATLK
QKVNTSAEITLINGGINTVAKGKGSFQWTPITATGSLAPVLEVVINGVTIRRSVTFTASA
FQPTTSSEVNFKILNDNRFLANNEDLRVQLITNATVNASETYVVQIKNAETVIWQDQYNL
FANSTRNITVTARNFSVVNGGLLSVSVNKLTRNLENFYKSRPAVVPPTNTTNATNGTNTT
TNVTKPAATTNATTNATNATNTTTNGTNSTNTTTGPVVVVRTFTFTPPDFANTTITTSFF
EPKGELLFFKRPADGLRVSVTFDKPVAYLPGDTVSYTVSIVNITTGRPVTVDSYVTLSIV
DVAGINGAHGSSLAARSYLSNQIKNFDNENLIAQPILTSIFSGANNDTRYVDVLLGVQGW
RIGAFDVRSIVNTATILRTASPADQQAIQSLYSAVVVNQTRPVATVVRPNSARSGRQANE
STPQDFMGNLTNPKAFAHPKRAGWTPAQKIDLTQTVAWSSTVVAKAGTLKGSIVLNDALT
SYSVVVDAFNAQGAVGSVNATILTRDSLVISYTLPKFMVVGDSLKIPVSIANQGSAALQV
KLFETLSDANLRVVVPTAAINLAANAAVSSFVTVTALTEKSGAVLNILANATVAGVTYSN
EVSGSVSIAARDFIYKTQTRGGLIGSTAKAAGTANTAVLNVDIPADSNSTGQQFSMTVYP
TFLSLVEQARRSLVAGPQGNFEEWSATVYPLIHRLTALRNGVQNADVQVQIVQLTQDIVA
QYNSLLTYRIQEGANFRFEGQDLSTEAMTAYALIFFTDFAVGNTFVDANFLVGLQNYLLS
RKNNRGGFIQSFSANSVGTPIPQITHDAFIIYALTYYSQTVNVATEILNLKSAADNQISA
NRVDSHLVALLANALYRLKRTTEAQVYADALVKAQNMDGSLIINNAAATSFNGANGTELV
LQTTSLAVFVWNNNLSRYTSSITNATGFLYSKINNGMIGSSVATSFGLKAVSTNFATFST
INGNGIFTVSVNDQLVSAVAFSPSNTDAINIDLTPFVNNRNNSRALAPGQSLVIQLSVVN
VTLPTAEKKDFRSIYSFNHRYMANASYVPPPPVNTTPEFTVTLTVGKTPVGLDAQNGKFF
NYTVSAKNIMIPGSSASGPVNVVLGSPSCLELDAAFANNLINSGAIVGWEVVDNGLTVLL
LRSLNAGETRSINVQYRQTFSGACTARDNLAYQANGDFEIAAKTRTV