Identifiers and Description

Gene Model Identifier

Contig1335.1.g127

Standard Name

MEX1d

Aliases

Contig1335_1_g127

Description

Zinc finger C-x8-C-x5-C-x3-H type (and similar)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00642 ) Zinc finger C-x8-C-x5-C-x3-H type (and similar)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001054200.0000000400154582995175hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1335.1.g127(coding)
ATGGAATAATTGTGCCACTTCGCACATGGTGATGCAGAACTCAGAAATGCTCATGATCCA
ATCACCCCAGAACAAATGGAACTTGCTTCAAACCAAGTAACTTTCCAAAAGCCTCACTAA
GTCAACGGTAGAGGAGGTGCTCAAGTAGGTTATCAAAGAGGTGGGTTTTAAGGCGGCAGA
GGAGGTCATCAGTAAATGTAATAAAATAATCAAATGAATGTTTAAGGGGTTAACACTGGA
GCTAACTTCAAGACTGTTAAGTGCAAGTTCTTTGATCAAGGAAAAAACTGTCCTTACGGA
AATAGATGTTCCTTCGCTCATGGATCTTAAGATCTTCGTCAGCAAACTGGATCCCAAATG
CCCCCTTCTATGCCACCTGCTGGTCTCGGAATGATGCCAGGGATGGCTATGCCTAATATG
AGCGCATTCTACGGTGGAATGGGAGGCATGCCAGGAATGCAACAAATGGGAGTTGGCATC
TAAAATCCTTAGGATATTATGTACCAAAGTATGTAGCAGCAACATCCTATGATGAATCCT
GCTATGATGGGCATGGGATTCCCAGGGATGATGGCTGCACCAGGAATGCAACAACAAAAT
TTGTATGGTTAAACTGCTAAAGCAGAACGATTCATGGAACCCTTTGTTGATCCAAATTTT
CAACAAATGCAATAGCAATTATCCACTAGAATTTTGATTAACCAACAAGAACAAGGCCCC
GATGGTTCTCTGATCAACAAAGAGTAATAAATGGACGTTATTTTGAATGAAGCTTCCAAT
GATTCAATAATGATGTTTAACAAGGCTACTATGTTGATCTCCCAAGGTCAAAATCAAGAA
GGTATGGGACTCATAATGAATCTCTACAATCAAAAGAAAGTTGCAATTATTCCTGTGACT
GCTGAATCCACTATCTCAGGCTCTTTGCAATATCAATAATGA


>Contig1335.1.g127(protein)
MEQLCHFAHGDAELRNAHDPITPEQMELASNQVTFQKPHQVNGRGGAQVGYQRGGFQGGR
GGHQQMQQNNQMNVQGVNTGANFKTVKCKFFDQGKNCPYGNRCSFAHGSQDLRQQTGSQM
PPSMPPAGLGMMPGMAMPNMSAFYGGMGGMPGMQQMGVGIQNPQDIMYQSMQQQHPMMNP
AMMGMGFPGMMAAPGMQQQNLYGQTAKAERFMEPFVDPNFQQMQQQLSTRILINQQEQGP
DGSLINKEQQMDVILNEASNDSIMMFNKATMLISQGQNQEGMGLIMNLYNQKKVAIIPVT
AESTISGSLQYQQ