Identifiers and Description

Gene Model Identifier

Contig631.0.g47

Standard Name

MEX1c

Aliases

Contig631_0_g47

Description

Zinc finger C-x8-C-x5-C-x3-H type (and similar)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00642 ) Zinc finger C-x8-C-x5-C-x3-H type (and similar)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000743007.997402223525235e-19hypothetical protein
SGDYDR151C0.0000000010002658722841845CTH1 SGDID:S000002558, Chr IV
from 765155-764178, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig631.0.g47(coding)
ATGATGCCTTAAAATGCTGGTGGAATGGGAGGCATGGACCCCTCCGCTATGATGATGGGC
ATGATGCCTGGACCCCCTATGGGAATGATGGGAATGGGGATGCCACCTATGTAGGGTATG
GGACCAGTTGGTGGAGCTATGAACCCACTGGGAGGATATAATAATCTTTATAAAACTTCC
CTGTGCAAACATTTCATGCAAACTAAGCATTGCCATGTGGGAGCTAAATGCCATTTTGCT
CACGGAGAGCATGAACTGAGGAAAGCCGATGATGCTTTACCAATTGAGCAGACCATGAAA
ATGATGAATATCCCATATAACAACTACAAAACACAGACTTGCAAGTATTTCGAGTTGTCC
GGAGGTAATTGCAAATTTGGCAAGAATTGCTCATTTGCACATGGTGGTTTTGAACTCAGA
AATCCTTACGATGCAGTGCCACTCAACGCTAACCCTGTAGTAACTGGATAGCCAGGATTT
GGACAGGGAGATATTTATGGACCAGGGACATCAGGCACAACAGCCGATGGAAGCTTAGAC
GCCTAAAACCCCACACCTTTTAAACAATCAGATGTGAAGATAATCATGAGTGACCCCACA
TCAAGTCAAATAAAACTGCACATTTTACAAGCAAGCACACACTTTCAATCTGGTAATAAA
GATGAAGGGCTGAAGATCATCAACTAGCTTCTTATGAGCGGAGATATTAGCATAGAATAT
CCATTATCCTATAATAAGCAGGCCAAGCAACAAATTCATCAATTCAATACTTAAGGAAGT
GATGACATGCAATTACATCATCAAGCCATGGGAAATAATTATTCATAAATGAACACTCAA
GCATCTTCTCAAGGGGCTCATTAACAGCAAAATATGATGATGTAATTCTGA


>Contig631.0.g47(protein)
MMPQNAGGMGGMDPSAMMMGMMPGPPMGMMGMGMPPMQGMGPVGGAMNPLGGYNNLYKTS
LCKHFMQTKHCHVGAKCHFAHGEHELRKADDALPIEQTMKMMNIPYNNYKTQTCKYFELS
GGNCKFGKNCSFAHGGFELRNPYDAVPLNANPVVTGQPGFGQGDIYGPGTSGTTADGSLD
AQNPTPFKQSDVKIIMSDPTSSQIKLHILQASTHFQSGNKDEGLKIINQLLMSGDISIEY
PLSYNKQAKQQIHQFNTQGSDDMQLHHQAMGNNYSQMNTQASSQGAHQQQNMMMQF